From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003392000
  • symbol?:
  • description?: phosphodiesterase

      descriptions from strain specific annotations:

    • phosphodiesterase
    • putative phosphoesterase
    • phosphoesterase, putative
    • putative metallophosphoesterase
    • Phosphodiesterase, MJ0936 family
    • phosphodiesterase, family
    • phosphoesterase family protein
  • strand?: +
  • coordinates?: 3754145..3754663
  • synteny block?: BlockID0024750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1108
    08BA02176:
    C248_1181
    11819-97:
    MS7_1109
    71193:
    ST398NM01_1148
    ECT-R 2:
    ECTR2_1006
    ED133:
    SAOV_1149
    ED98:
    SAAV_1120
    HO 5096 0412:
    SAEMRSA15_09820
    JH1:
    SaurJH1_1233
    JH9:
    SaurJH9_1211
    JKD6008:
    SAA6008_01106
    JKD6159:
    SAA6159_01006
    LGA251:
    SARLGA251_10640
    M013:
    M013TW_1085
    MRSA252:
    SAR1125
    MSHR1132:
    SAMSHR1132_09980
    MSSA476:
    SAS1086
    Mu3:
    SAHV_1143
    Mu50:
    SAV1153
    MW2:
    MW1035
    RF122:
    SAB1016
    ST398:
    SAPIG1148
    T0131:
    SAT0131_01195 (rpmJ)
    TCH60:
    HMPREF0772_12081
    TW20:
    SATW20_11460
    USA300_TCH1516:
    USA300HOU_1088
    VC40:
    SAVC_04925

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKWIIVSDNHTESGVLYQIYEMHPDADVYLHLGDSELAYDDTELSLFNRVKGNCDFYPE
    N315            MSKWIIVSDNHTESGVLYQIYEMHPDADVYLHLGDSEFAYDDTELSLFNRVKGNCDFYPE
    NCTC8325        MSKWIIVSDNHTESGVLYQIYEMHPDADVYLHLGDSEFAYDDTELSLFNRVKGNCDFYPE
    Newman          MSKWIIVSDNHTESGVLYQIYEMHPDADVYLHLGDSELAYDDTELSLFNRVKGNCDFYPE
    USA300_FPR3757  MSKWIIVSDNHTESGVLYQIYEMHPDADVYLHLGDSEFAYDDTELSLFNRVKGNCDFYPE
                    *************************************:**********************

    COL             FENEAVAKYNDVKAFYTHGHLYQVNRTRDLLAEKGLELGCLFAFYGHTHVAKYEYINGVH
    N315            FENEAVAKYNDVKAFYTHGHLYQVNRTRDLLAEKGLELGCLFAFYGHTHVAKYEYINGVH
    NCTC8325        FENEAVAKYNDVKAFYTHGHLYQVNRTRDLLAEKGLELGCLFAFYGHTHVAKYEYINGVH
    Newman          FENEAVAKYNDVKAFYTHGHLYQVNRTRDLLAEKGLELGCLFAFYGHTHVAKYEYINGVH
    USA300_FPR3757  FENEAVAKYNDVKAFYTHGHLYQVNRTRDLLAEKGLELGCLFAFYGHTHVAKYEYINGVH
                    ************************************************************

    COL             VINPGSISQSRSSMEETYAEVIIDDQTLHGTINFKNRHHETISHTTF
    N315            VINPGSISQSRSSMEETYAEVIIDDQTLHGTINFKNRHHETISHTTF
    NCTC8325        VINPGSISQSRSSMEETYAEVIIDDQTLHGTINFKNRHHETISHTTF
    Newman          VINPGSISQSRSSMEETYAEVIIDDQTLHGTINFKNRHHETISHTTF
    USA300_FPR3757  VINPGSISQSRSSMEETYAEVIIDDQTLHGTINFKNRHHETISHTTF
                    ***********************************************