From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003405000
  • symbol?: scc
  • description?: fibrinogen-binding protein

      descriptions from strain specific annotations:

    • fibrinogen-binding protein
    • fibrinogen-binding protein precursor-like protein
    • fibrinogen-binding protein precursor-related protein
    • Involved in expression of fibrinogen binding protein
    • staphylococcal complement inhibitor (SCIN)
  • strand?: +
  • coordinates?: 3760783..3761133
  • synteny block?: BlockID0024860
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1115
    08BA02176:
    C248_1187
    11819-97:
    MS7_1115
    71193:
    ST398NM01_1155
    ECT-R 2:
    ECTR2_1013
    ED133:
    SAOV_1156
    ED98:
    SAAV_1127
    HO 5096 0412:
    SAEMRSA15_09900
    JH1:
    SaurJH1_1240
    JH9:
    SaurJH9_1216
    JKD6008:
    SAA6008_01112 (scc)
    JKD6159:
    SAA6159_01011 (scc)
    LGA251:
    SARLGA251_10690 (scc)
    M013:
    M013TW_1091
    MRSA252:
    SAR1131
    MSHR1132:
    MSSA476:
    SAS1092
    Mu3:
    SAHV_1149
    Mu50:
    SAV1159
    MW2:
    MW1041
    RF122:
    SAB1022
    ST398:
    SAPIG1155
    T0131:
    SAT0131_01202 (rpmD)
    TCH60:
    HMPREF0772_12075
    TW20:
    SATW20_11510 (scc)
    USA300_TCH1516:
    USA300HOU_1095
    VC40:
    SAVC_04950

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFKKYILTGTLALLLSSTGIATIEGNKADASSLDKYLTESQFHDKRIAEELRTLLNKSN
    N315            MKFKKYILTGTLALLLSSTGIATIEGNKADASSLDKYLTESQFHDKRIAEELRTLLNKSN
    NCTC8325        MKFKKYILTGTLALLLSSTGIATIEGNKADASSLDKYLTESQFHDKRIAEELRTLLNKSN
    Newman          MKFKKYILTGTLALLLSSTGIATIEGNKADASSLDKYLTESQFHDKRIAEELRTLLNKSN
    USA300_FPR3757  MKFKKYILTGTLALLLSSTGIATIEGNKADASSLDKYLTESQFHDKRIAEELRTLLNKSN
                    ************************************************************

    COL             VYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
    N315            VYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
    NCTC8325        VYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
    Newman          VYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
    USA300_FPR3757  VYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
                    ********************************************************