From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003414000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 3762336..3762521
  • synteny block?: BlockID0024950
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1116
    08BA02176:
    C248_1188
    11819-97:
    MS7_1116
    71193:
    ECT-R 2:
    ECTR2_1015
    ED133:
    SAOV_1158c
    ED98:
    SAAV_1129
    HO 5096 0412:
    SAEMRSA15_09910
    JH1:
    SaurJH1_1242
    JH9:
    SaurJH9_1218
    JKD6008:
    SAA6008_01113
    JKD6159:
    SAA6159_01012
    LGA251:
    SARLGA251_10700
    M013:
    M013TW_1092
    MRSA252:
    SAR1133
    MSHR1132:
    SAMSHR1132_10030
    MSSA476:
    SAS1094
    Mu3:
    SAHV_1150
    Mu50:
    SAV1160
    MW2:
    MW1042
    RF122:
    SAB1024c
    ST398:
    SAPIG1156
    T0131:
    SAT0131_01203
    TCH60:
    TW20:
    SATW20_11520
    USA300_TCH1516:
    USA300HOU_1097
    VC40:
    SAVC_04955

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKHINKKAAKLLEDYKKVQQRKSKETDRGCLKSVIMLIVLFFLIIFGIVACSTNVNFFF
    N315            MNKHINKKATKLLEDYKKVQQRKSEETDRGCLKSVIMLIVLFFLIIFGIVACSTNVNFFF
    NCTC8325        MNKHINKKAAKLLEDYKKVQQRKSKETDRGCLKSVIMLIVLFFLIIFGIVACSTNVNFFF
    Newman          MNKHINKKAAKLLEDYKKVQQRKSKETDRGCLKSVIMLIVLFFLIIFGIVACSTNVNFFF
                    *********:**************:***********************************

    COL             Q
    N315            Q
    NCTC8325        Q
    Newman          Q
                    *