From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003416000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 3765335..3765568
  • synteny block?: BlockID0024970
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1117
    08BA02176:
    C248_1189
    11819-97:
    MS7_1117
    71193:
    ST398NM01_1157
    ECT-R 2:
    ECTR2_1016
    ED133:
    SAOV_1160c
    ED98:
    HO 5096 0412:
    SAEMRSA15_09930
    JH1:
    SaurJH1_1244
    JH9:
    SaurJH9_1220
    JKD6008:
    SAA6008_01114
    JKD6159:
    SAA6159_01013
    LGA251:
    SARLGA251_10720
    M013:
    M013TW_1093
    MRSA252:
    SAR1134
    MSHR1132:
    SAMSHR1132_10040
    MSSA476:
    SAS1096
    Mu3:
    SAHV_1151
    Mu50:
    SAV1161
    MW2:
    MW1043
    RF122:
    SAB1026c
    ST398:
    SAPIG1157
    T0131:
    SAT0131_01204
    TCH60:
    HMPREF0772_12072
    TW20:
    SATW20_11540
    USA300_TCH1516:
    USA300HOU_1098
    VC40:
    SAVC_04960

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVFNDWEINVVYSGEHEVVTNEKSLFVIDEFYDVAIAIYYLDGKLKVAHVNYGSDFTIDV
    N315            MVFNDWEINVVYSGEHEVVTNEKSLFVIDEFYDVAIAIYYLDGKLKVAHVNYGSDFTIDV
    NCTC8325        MVFNDWEINVVYSGEHEVVTNEKSLFVIDEFYDVAIAIYYLDGKLKVAHVNYGSDFTIDV
    Newman          MVFNDWEINVVYSGEHEVVTNEKSLFVIDEFYDVAIAIYYLDGKLKVAHVNYGSDFTIDV
    USA300_FPR3757  MVFNDWEINVVYSGEHEVVTNEKSLFVIDEFYDVAIAIYYLDGKLKVAHVNYGSDFTIDV
                    ************************************************************

    COL             ANKVFELNIQNPNVDEH
    N315            ANKVFELNIQNPNVDEH
    NCTC8325        ANKVFELNIQNPNVDEH
    Newman          ANKVFELNIQNPNVDEH
    USA300_FPR3757  ANKVFELNIQNPNVDEH
                    *****************