From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003427000
  • symbol?: ssl13
  • description?: staphylococcal superantigen-like protein 13
  • strand?: -
  • coordinates?: 3776271..3777261
  • synteny block?: BlockID0025080
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1123
    08BA02176:
    C248_1193
    11819-97:
    MS7_1122
    71193:
    ST398NM01_1161
    ECT-R 2:
    ECTR2_1021
    ED133:
    SAOV_1165c
    ED98:
    SAAV_1135
    HO 5096 0412:
    SAEMRSA15_09980
    JH1:
    SaurJH1_1250
    JH9:
    SaurJH9_1225
    JKD6008:
    SAA6008_01119
    JKD6159:
    SAA6159_01017
    LGA251:
    SARLGA251_10760
    M013:
    M013TW_1098
    MRSA252:
    SAR1140
    MSHR1132:
    SAMSHR1132_10080
    MSSA476:
    SAS1100
    Mu3:
    SAHV_1157
    Mu50:
    SAV1167
    MW2:
    MW1048
    RF122:
    SAB1031c
    ST398:
    SAPIG1161
    T0131:
    SAT0131_01210
    TCH60:
    HMPREF0772_12067
    TW20:
    SATW20_11590
    USA300_TCH1516:
    USA300HOU_1104
    VC40:
    SAVC_04985

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNNITKKIILSTTLLLLGTASTQFPNTPINSSSEAKAYYINQNETNVNELTKYYSQKYL
    N315            MNNNITKKIILSTTLLLLGTAFTQFPNTPINSSSEAKAYYINQNETNVNELTKYYSQKYL
    NCTC8325        MNNNITKKIILSTTLLLLGTASTQFPNTPINSSSEAKAYYINQNETNVNELTKYYSQKYL
    Newman          MNNNITKKIILSTTLLLLGTASTQFPNTPINSSSEAKAYYINQNETNVNELTKYYSQKYL
    USA300_FPR3757  MNNNITKKIILSTTLLLLGTASTQFPNTPINSSSEAKAYYINQNETNVNELTKYYSQKYL
                    ********************* **************************************

    COL             TFSNSTLWQKDNGTIHATLLQFSWYSHIQVYGPESWGNINQLRNKSVDIFGIKDQETIDS
    N315            TFSNSTLWQKDNGTIHATLLQFSWYSHIQVYGPESWGNINQLRNKSVDIFGIKDQETIDS
    NCTC8325        TFSNSTLWQKDNGTIHATLLQFSWYSHIQVYGPESWGNINQLRNKSVDIFGIKDQETIDS
    Newman          TFSNSTLWQKDNGTIHATLLQFSWYSHIQVYGPESWGNINQLRNKSVDIFGIKDQETIDS
    USA300_FPR3757  TFSNSTLWQKDNGTIHATLLQFSWYSHIQVYGPESWGNINQLRNKSVDIFGIKDQETIDS
                    ************************************************************

    COL             FALSQETFTGGVTPAATSNDKHYKLNVTYKDKAETFTGGFPVYEGNKPVLTLKELDFRIR
    N315            FALSQETFTGGVTPAATSNDKHYKLNVTYKDKAETFTGGFPVYEGNKPVLTLKELDFRIR
    NCTC8325        FALSQETFTGGVTPAATSNDKHYKLNVTYKDKAETFTGGFPVYEGNKPVLTLKELDFRIR
    Newman          FALSQETFTGGVTPAATSNDKHYKLNVTYKDKAETFTGGFPVYEGNKPVLTLKELDFRIR
    USA300_FPR3757  FALSQETFTGGVTPAATSNDKHYKLNVTYKDKAETFTGGFPVYEGNKPVLTLKELDFRIR
                    ************************************************************

    COL             QTLIKSKKLYNNSYNKGQIKITGADNNYTIDLSKRLPSTDANRYVKKPQNAKIEVILEKS
    N315            QTLIKSKKLYNNSYNKGQIKITGTDNNYTIDLSKRLPSTDANRYVKKPQNAKIEVILEKS
    NCTC8325        QTLIKSKKLYNNSYNKGQIKITGADNNYTIDLSKRLPSTDANRYVKKPQNAKIEVILEKS
    Newman          QTLIKSKKLYNNSYNKGQIKITGADNNYTIDLSKRLPSTDANRYVKKPQNAKIEVILEKS
    USA300_FPR3757  QTLIKSKKLYNNSYNKGQIKITGADNNYTIDLSKRLPSTDANRYVKKPQNAKIEVILEKS
                    ***********************:************************************

    COL             N
    N315            N
    NCTC8325        N
    Newman          N
    USA300_FPR3757  N
                    *