From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003434000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3784749..3784976
  • synteny block?: BlockID0025150
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1128
    08BA02176:
    C248_1198
    11819-97:
    MS7_1127
    71193:
    ST398NM01_1166
    ECT-R 2:
    ECTR2_1026
    ED133:
    ED98:
    SAAV_1140
    HO 5096 0412:
    SAEMRSA15_10030
    JH1:
    SaurJH1_1255
    JH9:
    SaurJH9_1230
    JKD6008:
    SAA6008_01124
    JKD6159:
    SAA6159_01022
    LGA251:
    SARLGA251_10810
    M013:
    M013TW_1103
    MRSA252:
    SAR1146
    MSHR1132:
    SAMSHR1132_10130
    MSSA476:
    SAS1105
    Mu3:
    SAHV_1162
    Mu50:
    SAV1172
    MW2:
    MW1053
    RF122:
    ST398:
    SAPIG1166
    T0131:
    SAT0131_01216 (rplE)
    TCH60:
    HMPREF0772_12061
    TW20:
    SATW20_11640
    USA300_TCH1516:
    USA300HOU_1109
    VC40:
    SAVC_05010

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MTHLTKVLDTLTGICVVLLFSKYFVAYANMVFDWNLRWYLLENIPHLPIILFILMFIFGV
    NCTC8325        MTHLTKVLDTLTGICVVLLFSKYFVAYANMVFDWNLRWYLLENIPHLPIILFILMFIFGV
                    ************************************************************

    N315            PSEMIKDRQRKNNGV
    NCTC8325        PSEMIKDRQRKNNGV
                    ***************