From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN003437000
  • symbol?:
  • description?: putative DNA-binding protein
  • strand?: +
  • coordinates?: 3786518..3786706
  • synteny block?: BlockID0025180
  • occurrence?: in 47% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1130
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    SAAV_1142
    HO 5096 0412:
    SAEMRSA15_10050
    JH1:
    JH9:
    JKD6008:
    SAA6008_01126
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1107
    Mu3:
    SAHV_1164
    Mu50:
    SAV1174
    MW2:
    MW1055
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    SATW20_11660
    USA300_TCH1516:
    USA300HOU_1111
    VC40:
    SAVC_05020

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRNQIQKLLDSDLSSLHISKQTGVPQSTIHRMRKNERSLDNMSLKNAELLYKFANSIFSN
    N315            MRNQIQKLLDSDLSSLHISKQTGVPQSTIHRMRKKERSLDNMSLKNAELLYKFANSIFSN
    NCTC8325        MRNQIQKLLDSDLSSLHISKQTGVPQSTIHRMRKNERSLDNMSLKNAELLYKFANSIFSN
    Newman          -------------------------------MRKNERSLDNMSLKNAELLYKFANSIFSN
                                                   ***:*************************

    COL             EN
    N315            EN
    NCTC8325        EN
    Newman          EN
                    **