From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003461000
  • symbol?:
  • description?: cell division protein

      descriptions from strain specific annotations:

    • cell division protein
    • cell division protein (putative)
    • cell division protein YlmG/Ycf19 (putative),YggT family
    • integral membrane protein
    • membrane protein
    • yggt family, putative
  • strand?: +
  • coordinates?: 3805100..3805390
  • synteny block?: BlockID0025410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1203 (ylmG)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1148
    08BA02176:
    C248_1219
    11819-97:
    MS7_1147
    71193:
    ST398NM01_1188
    ECT-R 2:
    ECTR2_1046
    ED133:
    SAOV_1191
    ED98:
    SAAV_1161 (ylmG)
    HO 5096 0412:
    SAEMRSA15_10230
    JH1:
    SaurJH1_1274
    JH9:
    SaurJH9_1249
    JKD6008:
    SAA6008_01144 (ylmG)
    JKD6159:
    SAA6159_01041 (ylmG)
    LGA251:
    SARLGA251_11010
    M013:
    M013TW_1124
    MRSA252:
    SAR1166
    MSHR1132:
    SAMSHR1132_10320
    MSSA476:
    SAS1124
    Mu3:
    SAHV_1180
    Mu50:
    SAV1190
    MW2:
    MW1073
    RF122:
    SAB1054
    ST398:
    SAPIG1188
    T0131:
    SAT0131_01237
    TCH60:
    HMPREF0772_12042 (ylmG)
    TW20:
    SATW20_11840
    USA300_TCH1516:
    USA300HOU_1127
    VC40:
    SAVC_05115

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDINVLATIFKFILFVVEIYYFGMIIYFFTSWVPSIRETKVGYFLAKIYEPFLQPFRKVI
    N315            MDINVLATIFKFILFVVEIYYFGMIIYFFTSWVPSIRETKVGYFLAKIYEPFLQPFRKVI
    NCTC8325        MDINVLATIFKFILFVVEIYYFGMIIYFFTSWVPSIRETKVGYFLAKIYEPFLQPFRKVI
    Newman          MDINVLATIFKFILFVVEIYYFGMIIYFFTSWVPSIRETKVGYFLAKIYEPFLQPFRKVI
    USA300_FPR3757  MDINVLATIFKFILFVVEIYYFGMIIYFFTSWVPSIRETKVGYFLAKIYEPFLQPFRKVI
                    ************************************************************

    COL             PPIGIIDISSIAAIIVLVLFQKGLLQIFNWILIQLQ
    N315            PPIGIIDISSIAAIIVLVLFQKGLLQIFNWILIQLQ
    NCTC8325        PPIGIIDISSIAAIIVLVLFQKGLLQIFNWILIQLQ
    Newman          PPIGIIDISSIAAIIVLVLFQKGLLQIFNWILIQLQ
    USA300_FPR3757  PPIGIIDISSIAAIIVLVLFQKGLLQIFNWILIQLQ
                    ************************************