From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003469000
  • symbol?:
  • description?: glyoxalase/bleomycin resistance protein/dioxygenase

      descriptions from strain specific annotations:

    • glyoxalase/bleomycin resistance protein/dioxygenase
    • glyoxalase family protein
    • ring-cleavage extradiol dioxygenase
    • glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein
    • lactoylglutathione lyase
    • putative ring-cleavage extradiol dioxygenase
    • pseudogene
  • strand?: +
  • coordinates?: 3811360..3812157
  • synteny block?: BlockID0025490
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1152
    08BA02176:
    C248_1223
    11819-97:
    MS7_1151
    71193:
    ST398NM01_1192
    ECT-R 2:
    ECTR2_1050
    ED133:
    SAOV_1195
    ED98:
    SAAV_1166
    HO 5096 0412:
    SAEMRSA15_10270
    JH1:
    SaurJH1_1278
    JH9:
    SaurJH9_1253
    JKD6008:
    SAA6008_01148
    JKD6159:
    SAA6159_01045
    LGA251:
    SARLGA251_11050
    M013:
    M013TW_1128
    MRSA252:
    SAR1171
    MSHR1132:
    SAMSHR1132_10360
    MSSA476:
    SAS1128
    Mu3:
    SAHV_1184
    Mu50:
    SAV1194
    MW2:
    MW1077
    RF122:
    SAB1058
    ST398:
    SAPIG1192
    T0131:
    SAT0131_01241
    TCH60:
    HMPREF0772_12037 (gloA2)
    TW20:
    SATW20_11880
    USA300_TCH1516:
    USA300HOU_1131
    VC40:
    SAVC_05135

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYHNSNANFVNGITLNVRDKNELKPFYEDILGLNIINETLTSIQYEVGQNNHVITLVELQ
    N315            MYHNSNANFVNGITLNVRDKNELKPFYEDVLGLNIINETLTSIQYEVGQNNHVITLVELQ
    NCTC8325        MYHNSNANFVNGITLNVRDKNELKPFYEDILGLNIINETLTSIQYEVGQNNHVITLVELQ
    Newman          MYHNSNANFVNGITLNVRDKNELKPFYEDILGLNIINETLTSIQYEVGQNNHVITLVELQ
    USA300_FPR3757  MYHNSNANFVNGITLNVRDKNELKPFYEDILGLNIINETLTSIQYEVGQNNHVITLVELQ
                    *****************************:******************************

    COL             NGREPLMSEAGLFHIAIKLPQISDLANLLIHLSEYDIPVNGGIQPASLSLFFEDPEGNGF
    N315            NGREPLMSEAGLFHIAIKLPQISDLANLLIHLSEYDIPVNGGIQPASLSLFFEDPEGNGF
    NCTC8325        NGREPLMSEAGLFHIAIKLPQISDLANLLIHLSEYDIPVNGGIQPASLSLFFEDPEGNGF
    Newman          NGREPLMSEAGLFHIAIKLPQISDLANLLIHLSEYDIPVNGGIQPASLSLFFEDPEGNGF
    USA300_FPR3757  NGREPLMSEAGLFHIAIKLPQISDLANLLIHLSEYDIPVNGGIQPASLSLFFEDPEGNGF
                    ************************************************************

    COL             KFYVDKDEAQWTRQNNLVKIDIRPLNVPRLVSHATKLLWLGIPDDAIIGALHIKTIHLSE
    N315            KFYVDKDEAQWTRQNDLVKIDIRPLNVPRLVSHATKLLWLGIPDDAIIGALHIKTIHLSE
    NCTC8325        KFYVDKDEAQWTRQNNLVKIDIRPLNVPRLVSHATKLLWLGIPDDAIIGALHIKTIHLSE
    Newman          KFYVDKDEAQWTRQNNLVKIDIRPLNVPRLVSHATKLLWLGIPDDAIIGALHIKTIHLSE
    USA300_FPR3757  KFYVDKDEAQWTRQNNLVKIDIRPLNVPRLVSHATKLLWLGIPDDAIIGALHIKTIHLSE
                    ***************:********************************************

    COL             VKEYYLDYFGLEQSAYMDDYSIFLASNGYYQHLAMNDWVSATKRVENFDTYGLAIVDFHY
    N315            VKEYYLDYFGLEQSAYMDDYSIFLASNGYYQHLAMNDWVSATKRVENFDTYGLAIVDFHY
    NCTC8325        VKEYYLDYFGLEQSAYMDDYSIFLASNGYYQHLAMNDWVSATKRVENFDTYGLAIVDFHY
    Newman          VKEYYLDYFGLEQSAYMDDYSIFLASNGYYQHLAMNDWVSATKRVENFDTYGLAIVDFHY
    USA300_FPR3757  VKEYYLDYFGLEQSAYMDDYSIFLASNGYYQHLAMNDWVSATKRVENFDTYGLAIVDFHY
                    ************************************************************

    COL             PETTHLNLQGPDGIYYRFNHIEVED
    N315            PETTHLNLQGPDGIYYRFNHIEVED
    NCTC8325        PETTHLNLQGPDGIYYRFNHIEVED
    Newman          PETTHLNLQGPDGIYYRFNHIEVED
    USA300_FPR3757  PETTHLNLQGPDGIYYRFNHIEVED
                    *************************