From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003487000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3827470..3827682
  • synteny block?: BlockID0025660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1164
    08BA02176:
    C248_1235
    11819-97:
    MS7_1163
    71193:
    ST398NM01_1203
    ECT-R 2:
    ECTR2_1061
    ED133:
    SAOV_1209
    ED98:
    SAAV_1177
    HO 5096 0412:
    SAEMRSA15_10390
    JH1:
    SaurJH1_1290
    JH9:
    SaurJH9_1265
    JKD6008:
    SAA6008_01160
    JKD6159:
    SAA6159_01059
    LGA251:
    SARLGA251_11170
    M013:
    M013TW_1143
    MRSA252:
    SAR1182
    MSHR1132:
    SAMSHR1132_10470
    MSSA476:
    SAS1140
    Mu3:
    SAHV_1196
    Mu50:
    SAV1206
    MW2:
    MW1089
    RF122:
    SAB1070
    ST398:
    SAPIG1203
    T0131:
    SAT0131_01254 (mobA)
    TCH60:
    HMPREF0772_12026
    TW20:
    SATW20_12000
    USA300_TCH1516:
    USA300HOU_1144
    VC40:
    SAVC_05195

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNDKTSNDLYGKIKHCNEFINHSNDSNLSSSHDVDESSTKQKHIKNKTTIDHNDDLFKHV
    N315            MNDKTSNDLYGKIKHCNEFINHSNDSNLSSSHDVDESSTKQKHIKNKTTIDHNDDLFKHV
    NCTC8325        MNDKTSNDLYGKIKHCNEFINHSNDSNLSSSHDVDESSTKQKHIKNKTTIDHNDDLFKHV
    Newman          MNDKTSNDLYGKIKHCNEFINHSNDSNLSSSHDVDESSTKQKHIKNKTTIDHNDDLFKHV
    USA300_FPR3757  MNDKTSNDLYGKIKHCNEFINHSNDSNLSSSHDVDESSTKQKHIKNKTTIDHNDDLFKHV
                    ************************************************************

    COL             KDILRKQEQI
    N315            KDILRKQGQI
    NCTC8325        KDILRKQGQI
    Newman          KDILRKQEQI
    USA300_FPR3757  KDILRKQEQI
                    ******* **