From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003488000
  • symbol?:
  • description?: VOC family protein

      descriptions from strain specific annotations:

    • VOC family protein
    • 3-demethylubiquinone-9 3-methyltransferase
    • glyoxalase
    • PhnB protein
  • strand?: +
  • coordinates?: 3828130..3828531
  • synteny block?: BlockID0025670
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1165
    08BA02176:
    C248_1236
    11819-97:
    MS7_1164
    71193:
    ST398NM01_1204
    ECT-R 2:
    ECTR2_1062
    ED133:
    SAOV_1210
    ED98:
    SAAV_1178
    HO 5096 0412:
    SAEMRSA15_10400
    JH1:
    SaurJH1_1291
    JH9:
    SaurJH9_1266
    JKD6008:
    SAA6008_01161
    JKD6159:
    SAA6159_01060
    LGA251:
    SARLGA251_11180
    M013:
    M013TW_1144
    MRSA252:
    SAR1183
    MSHR1132:
    SAMSHR1132_10480
    MSSA476:
    SAS1141
    Mu3:
    SAHV_1197
    Mu50:
    SAV1207
    MW2:
    MW1090
    RF122:
    SAB1071
    ST398:
    SAPIG1204
    T0131:
    SAT0131_01255 (moaD)
    TCH60:
    HMPREF0772_12025
    TW20:
    SATW20_12010
    USA300_TCH1516:
    USA300HOU_1145
    VC40:
    SAVC_05200

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDIPKITTFLMFNNQAEEAVKLYTSLFEDSEIITMAKYGENGPGDPGTVQHSIFTLNGQV
    N315            MDIPKITTFLMFNNKAEEAVKLYTSLFEDSEIITMAKYGENGPGDHGTVQHSIFTLNGQV
    NCTC8325        MDIPKITTFLMFNNQAEEAVKLYTSLFEDSEIITMAKYGENGPGDPGTVQHSIFTLNGQV
    Newman          MDIPKITTFLMFNNQAEEAVKLYTSLFEDSEIITMAKYGENGPGDPGTVQHSIFTLNGQV
    USA300_FPR3757  MDIPKITTFLMFNNQAEEAVKLYTSLFEDSEIITMAKYGENGPGDPGTVQHSIFTLNGQV
                    **************:****************************** **************

    COL             FMAIDANSGTELPMNPAISLFVTVKDTIEMERLFNGLKDEGAILMPKTNMPPYREFAWVQ
    N315            FMAIDANSGTELPMNPAISLFVTVKDTIEMERLFNGLKDEGAILMPKTNMPPYREFAWVQ
    NCTC8325        FMAIDANSGTELPMNPAISLFVTVKDTIEMERLFNGLKDEGAILMPKTNMPPYREFAWVQ
    Newman          FMAIDANSGTELPMNPAISLFVTVKDTIEMERLFNGLKDEGAILMPKTNMPPYREFAWVQ
    USA300_FPR3757  FMAIDANSGTELPMNPAISLFVTVKDTIEMERLFNGLKDEGAILMPKTNMPPYREFAWVQ
                    ************************************************************

    COL             DKFGVSFQLALPE
    N315            DKFGVSFQLALPE
    NCTC8325        DKFGVSFQLALPE
    Newman          DKFGVSFQLALPE
    USA300_FPR3757  DKFGVSFQLALPE
                    *************