From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003490000
  • symbol?:
  • description?: fibronectin/fibrinogen binding-like protein

      descriptions from strain specific annotations:

    • fibronectin/fibrinogen binding-like protein
    • fibrinogen-binding protein A-like protein
    • putative fibronectin/fibrinogen binding protein
    • Fibronectin/fibrinogen-binding protein
    • fibrinogen binding protein
    • fibronectin/fibrinogen binding-related protein
    • fibronectin-binding A domain-containing protein
    • fibronectin-binding A domain protein
  • strand?: -
  • coordinates?: 3829099..3830831
  • synteny block?: BlockID0025690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1166
    08BA02176:
    C248_1238
    11819-97:
    MS7_1166
    71193:
    ST398NM01_1206
    ECT-R 2:
    ECTR2_1064
    ED133:
    SAOV_1211c
    ED98:
    SAAV_1180
    HO 5096 0412:
    SAEMRSA15_10410
    JH1:
    SaurJH1_1292
    JH9:
    SaurJH9_1267
    JKD6008:
    SAA6008_01163 (fbpA)
    JKD6159:
    SAA6159_01061 (fbpA)
    LGA251:
    SARLGA251_11190
    M013:
    M013TW_1146
    MRSA252:
    SAR1184
    MSHR1132:
    SAMSHR1132_10490
    MSSA476:
    SAS1142
    Mu3:
    SAHV_1198
    Mu50:
    SAV1208
    MW2:
    MW1091
    RF122:
    SAB1072c
    ST398:
    SAPIG1206
    T0131:
    SAT0131_01257
    TCH60:
    HMPREF0772_12024 (fbe)
    TW20:
    SATW20_12020
    USA300_TCH1516:
    USA300HOU_1146 (fbpA)
    VC40:
    SAVC_05205

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAYDGLFTKKMVESLQFLTTGRVHKINQPDNDTILMVVRQNRQNHQLLLSIHPNFSRLQL
    N315            MAYDGLFTKKMVESLQFLTTGRVHKINQPDNDTILMVVRQNRQNHQLLLSIHPNFSRLQL
    NCTC8325        MAYDGLFTKKMVESLQFLTTGRVHKINQPDNDTILMVVRQNRQNHQLLLSIHPNFSRLQL
    Newman          MAYDGLFTKKMVESLQFLTTGRVHKINQPDNDTILMVVRQNRQNHQLLLSIHPNFSRLQL
    USA300_FPR3757  MAYDGLFTKKMVESLQFLTTGRVHKINQPDNDTILMVVRQNRQNHQLLLSIHPNFSRLQL
                    ************************************************************

    COL             TTKKYDNPFNPPMFARVFRKHLEGGIIESIKQIGNDRRIEIDIKSKDEIGDTIYRTVILE
    N315            TTKKYDNPFNPPMFARVFRKHLEGGIIESIKQIGNDRRIEIDIKSKDEIGDTIYRTVILE
    NCTC8325        TTKKYDNPFNPPMFARVFRKHLEGGIIESIKQIGNDRRIEIDIKSKDEIGDTIYRTVILE
    Newman          TTKKYDNPFNPPMFARVFRKHLEGGIIESIKQIGNDRRIEIDIKSKDEIGDTIYRTVILE
    USA300_FPR3757  TTKKYDNPFNPPMFARVFRKHLEGGIIESIKQIGNDRRIEIDIKSKDEIGDTIYRTVILE
                    ************************************************************

    COL             IMGKHSNLILVDENRKIIEGFKHLTPNTNHYRTVMPGFNYEAPPTQHKINPYDITGAEVL
    N315            IMGKHSNLILVDENRKIIEGFKHLTPNTNHYRTVMPGFNYEAPPTQHKINPYDITGAEVL
    NCTC8325        IMGKHSNLILVDENRKIIEGFKHLTPNTNHYRTVMPGFNYEAPPTQHKINPYDITGAEVL
    Newman          IMGKHSNLILVDENRKIIEGFKHLTPNTNHYRTVMPGFNYEAPPTQHKINPYDITGAEVL
    USA300_FPR3757  IMGKHSNLILVDENRKIIEGFKHLTPNTNHYRTVMPGFNYEAPPTQHKINPYDITGAEVL
                    ************************************************************

    COL             KYIDFNAGNIAKQLLNQFEGFSPLITNEIVSRRQFMTSSTLPEAFDEVMAETKLPPTPIF
    N315            KYIDFNAGNIAKQLLNQFEGFSPLITNEIVSRRQFMTSSTLPEAFDEVMAETKLPPTPIF
    NCTC8325        KYIDFNAGNIAKQLLNQFEGFSPLITNEIVSRRQFMTSSTLPEAFDEVMAETKLPPTPIF
    Newman          KYIDFNAGNIAKQLLNQFEGFSPLITNEIVSRRQFMTSSTLPEAFDEVMAETKLPPTPIF
    USA300_FPR3757  KYIDFNAGNIAKQLLNQFEGFSPLITNEIVSRRQFITSSTLPEAFDEVMAETKLPPTPIF
                    ***********************************:************************

    COL             HKNHETGKEDFYFIKLNQFNDDTVTYDSLNDLLDRFYDARGERERVKQRANDLVRFVQQQ
    N315            HKNHETGKEDFYFIKLNQFNDDTVTYDSLNDLLDRFYDARGERERVKQRANDLVRFVQQQ
    NCTC8325        HKNHETGKEDFYFIKLNQFNDDTVTYDSLNDLLDRFYDARGERERVKQRANDLVRFVQQQ
    Newman          HKNHETGKEDFYFIKLNQFNDDTVTYDSLNDLLDRFYDARGERERVKQRANDLVRFVQQQ
    USA300_FPR3757  HKNHETGKEDFYFIKLNQFNDDTVTYDSLNDLLDRFYDARGERERVKQRANDLVRFVQQQ
                    ************************************************************

    COL             LHKYQNKLAKLIEEYEQSKNKDTEQLYGELITANIYRIKQGDKEVTALNYYTNEEVVIPL
    N315            LHKYQNKLAKLIEEYEQSKNKDTEQLYGELITANIYRIKQGDKEVTALNYYTNEEVVIPL
    NCTC8325        LHKYQNKLAKLIEEYEQSKNKDTEQLYGELITANIYRIKQGDKEVTALNYYTNEEVVIPL
    Newman          LHKYQNKLAKLIEEYEQSKNKDTEQLYGELITANIYRIKQGDKEVTALNYYTNEEVVIPL
    USA300_FPR3757  LYKYQNKLAKLIEEYEQSKNKDTEQLYGELITANIYRIKQGDKEVTALNYYTNEEVVIPL
                    *:**********************************************************

    COL             NPTKSPSANAQYYYKQYNRMKTRERELQHQIQLTKDNIDYFSTIEQQLHHISVHDIDEIR
    N315            NPTKSPSANAQYYYKQYNRMKTRERELQHQIQLTKDNIDYFSTIEQQLHHISVHDIDEIR
    NCTC8325        NPTKSPSANAQYYYKQYNRMKTRERELQHQIQLTKDNIDYFSTIEQQLHHISVHDIDEIR
    Newman          NPTKSPSANAQYYYKQYNRMKTRERELQHQIQLTKDNIDYFSTIEQQLHHISVHDIDEIR
    USA300_FPR3757  NPTKSPSANAQYYYKQYNRMKTRERELQHQIQLTKDNIDYFSTIEQQLHHISVHDIDEIR
                    ************************************************************

    COL             DELAEQGFMKQRKNQTKKKKAQIQLQHYVSTDGDDIYVGKNNKQNDYLTNKKAKKTHTWL
    N315            DELAEQGFMKQRKNQTKKKKAQIQLQHYVSTDGDDIYVGKNNKQNDYLTNKKAKKTHTWL
    NCTC8325        DELAEQGFMKQRKNQTKKKKAQIQLQHYVSTDGDDIYVGKNNKQNDYLTNKKAKKTHTWL
    Newman          DELAEQGFMKQRKNQTKKKKAQIQLQHYVSTDGDDIYVGKNNKQNDYLTNKKAKKTHTWL
    USA300_FPR3757  DELAEQGFMKQRKNQTKKKKAQIQLQHYVSTDGDDIYVGKNNKQNDYLTNKKAKKTHTWL
                    ************************************************************

    COL             HTKDIPGSHVVIFNDAPSDTTIKEAAMLAGYFSKAGNSGQIPVDYTLIKNVHKPSGAKPG
    N315            HTKDIPGSHVVIFNDAPSDTTIKEAAMLAGYFSKAGNSGQIPVDYTLIKNVHKPSGAKPG
    NCTC8325        HTKDIPGSHVVIFNDAPSDTTIKEAAMLAGYFSKAGNSGQIPVDYTLIKNVHKPSGAKPG
    Newman          HTKDIPGSHVVIFNDAPSDTTIKEAAMLAGYFSKAGNSGQIPVDYTLIKNVHKPSGAKPG
    USA300_FPR3757  HTKDIPGSHVVIFNDAPSDTTIKEAAMLAGYFSKAGNSGQIPVDYTLIKNVHKPSGAKPG
                    ************************************************************

    COL             FVTYDNQKTLYATPDYELIQKMKQS
    N315            FVTYDNQKTLYATPDYELIQKMKQL
    NCTC8325        FVTYDNQKTLYATPDYELIQKMKQS
    Newman          FVTYDNQKTLYATPDYELIQKMKQS
    USA300_FPR3757  FVTYDNQKTLYATPDYELIQKMKQS
                    ************************