From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003493000
  • symbol?: coaBC
  • description?: phosphopantothenoylcysteine decarboxylase

      descriptions from strain specific annotations:

    • phosphopantothenoylcysteine decarboxylase
    • phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase
    • bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase
    • pantothenate metabolism flavoprotein
    • coenzyme A biosynthesis bifunctional protein CoaBC
    • Phosphopantothenoylcysteine decarboxylase / Phosphopantothenoylcysteine synthetase
    • putative flavoprotein
  • strand?: +
  • coordinates?: 3832169..3833374
  • synteny block?: BlockID0025720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1223 (coaBC)
    N315:
    NCTC8325:
    Newman:
    NWMN_1121 (coaBC)
    USA300_FPR3757:
    SAUSA300_1104 (coaBC)
    04-02981:
    SA2981_1169
    08BA02176:
    C248_1241
    11819-97:
    MS7_1169 (coaBC)
    71193:
    ST398NM01_1209
    ECT-R 2:
    ECTR2_1067 (coaBC)
    ED133:
    SAOV_1214
    ED98:
    SAAV_1183 (coaBC)
    HO 5096 0412:
    SAEMRSA15_10440
    JH1:
    SaurJH1_1295
    JH9:
    SaurJH9_1270
    JKD6008:
    SAA6008_01166 (coaBC)
    JKD6159:
    SAA6159_01064 (coaBC)
    LGA251:
    SARLGA251_11220
    M013:
    M013TW_1149
    MRSA252:
    SAR1187
    MSHR1132:
    SAMSHR1132_10520
    MSSA476:
    SAS1145
    Mu3:
    SAHV_1201
    Mu50:
    SAV1211
    MW2:
    MW1094
    RF122:
    SAB1075
    ST398:
    SAPIG1209 (coaBC)
    T0131:
    SAT0131_01260 (moeA)
    TCH60:
    HMPREF0772_12021 (coaBC)
    TW20:
    SATW20_12050
    USA300_TCH1516:
    USA300HOU_1149
    VC40:
    SAVC_05220

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNMKKILLAVTGGIAAYKAIDLTSKLTQSGYEVRVMLTNHAQKFVTPLAFQAISRNAVYT
    N315            --MKKILLAVTGGIAAYKAIDLTSKLTQSGYEVRVMLTNHAQKFVTPLAFQAISRNAVYT
    NCTC8325        --MKKILLAVTGGIAAYKAIDLTSKLTQSGYEVRVMLTNHAQKFVTPLAFQAISRNAVYT
    Newman          --MKKILLAVTGGIAAYKAIDLTSKLTQSGYEVRVMLTNHAQKFVTPLAFQAISRNAVYT
    USA300_FPR3757  --MKKILLAVTGGIAAYKAIDLTSKLTQSGYEVRVMLTNHAQKFVTPLAFQAISRNAVYT
                      **********************************************************

    COL             DTFIEENPSEIQHIALGDWADAIIVAPATANTIAKLSVGIADDLVTSTLLATETPKFIAP
    N315            DTFIEENPSEIQHIALGDWADAIIVAPATANTIAKLSVGIADDLVTSTLLATETPKFIAP
    NCTC8325        DTFIEENPSEIQHIALGDWADAIIVAPATANTIAKLSVGIADDLVTSTLLATETPKFIAP
    Newman          DTFIEENPSEIQHIALGDWADAIIVAPATANTIAKLSVGIADDLVTSTLLATETPKFIAP
    USA300_FPR3757  DTFIEENPSEIQHIALGDWADAIIVAPATANTIAKLSVGIADDLVTSTLLATETPKFIAP
                    ************************************************************

    COL             AMNVHMYENKRTQQNINILKEDGYHFIEPGSGFLACGYVAKGRMEEPLQIVSVIDAHFQN
    N315            AMNVHMYENKRTQQNINILKEDGYHFIEPGSGFLACGYVAKGRMEEPLQIVSVIDAHFQN
    NCTC8325        AMNVHMYENKRTQQNINILKEDGYHFIEPGSGFLACGYVAKGRMEEPLQIVSVIDAHFQN
    Newman          AMNVHMYENKRTQQNINILKEDGYHFIEPGSGFLACGYVAKGRMEEPLQIVSVIDAHFQN
    USA300_FPR3757  AMNVHMYENKRTQQNINILKEDGYHFIEPGSGFLACGYVAKGRMEEPLQIVSVIDAHFQN
                    ************************************************************

    COL             SNRLANSSFQDKRALVTAGPTIEVIDPVRFVSNRSSGKMGYAIAEALRNRGAIVTLVAGP
    N315            SNRLANSSFQDKRALVTAGPTIEVIDPVRFVSNRSSGKMGYAIAEALRNRGAIVTLVAGP
    NCTC8325        SNRLANSSFQDKRALVTAGPTIEVIDPVRFVSNRSSGKMGYAIAEALRNRGAIVTLVAGP
    Newman          SNRLANSSFQDKRALVTAGPTIEVIDPVRFVSNRSSGKMGYAIAEALRNRGAIVTLVAGP
    USA300_FPR3757  SNRLANSSFQDKRALVTAGPTIEVIDPVRFVSNRSSGKMGYAIAEALRNRGAIVTLVAGP
                    ************************************************************

    COL             TTLEDPKDIEVIHVQSAEEMFEQVTSRFDEQDIVVKAAAVSDYTPIDVLEHKMKKQDGDL
    N315            TTLEDPKDIEVIHVQSAEEMFEQVTSRFDEQDIVVKAAAVSDYTPVDVLEHKMKKQDGDL
    NCTC8325        TTLEDPKDIEVIHVQSAEEMFEQVTSRFDEQDIVVKAAAVSDYTPVDVLEHKMKKQDGDL
    Newman          TTLEDPKDIEVIHVQSAEEMFEQVTSRFDEQDIVVKAAAVSDYTPVDVLEHKMKKQDGDL
    USA300_FPR3757  TTLEDPKDIEVIHVQSAEEMFEQVTSRFDEQDIVVKAAAVSDYTPVDVLEHKMKKQDGDL
                    *********************************************:**************

    COL             SVSFKRTKDILKYLGEHKTSQYLIGFAAETEDIENYAQQKLRKKNADVIISNNVGDMSIG
    N315            SVSFKRTKDILKYLGEHKTSQYLIGFAAETEDIENYAQQKLRKKNADVIISNNVGDMSIG
    NCTC8325        SVSFKRTKDILKYLGEHKTSQYLIGFAAETEDIENYAQQKLRKKNADVIISNNVGDMSIG
    Newman          SVSFKRTKDILKYLGEHKTSQYLIGFAAETEDIENYAQQKLRKKNADVIISNNVGDMSIG
    USA300_FPR3757  SVSFKRTKDILKYLGEHKTSQYLIGFAAETEDIENYAQQKLRKKNADVIISNNVGDMSIG
                    ************************************************************

    COL             FSSDDNELTMHFKNNEKVNIKKGKKVVLAAQILDELETRWQ
    N315            FSSDDNELTMHFKNNEKVNIKKGKKVVLAAQILDELETRWQ
    NCTC8325        FSSDDNELTMHFKNNEKVNIKKGKKVVLAAQILDELETRWQ
    Newman          FSSDDNELTMHFKNNEKVNIKKGKKVVLAAQILDELETRWQ
    USA300_FPR3757  FSSDDNELTMHFKNNEKVNIKKGKKVVLAAQILDELETRWQ
                    *****************************************