From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003494000
  • symbol?: priA
  • description?: primosomal protein N`

      descriptions from strain specific annotations:

    • primosomal protein N`
    • PriA, primosomal protein
    • Helicase PriA essential for oriC/DnaA-independent DNA replication
    • DNA replication factor Y
    • primosomal protein
    • primosomal protein N' (ATP-dependent helicase PriA)(Replication factor Y)
    • primosomal protein N prime
  • strand?: +
  • coordinates?: 3833365..3835782
  • synteny block?: BlockID0025730
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1224 (priA)
    N315:
    SA1055 (priA)
    NCTC8325:
    Newman:
    NWMN_1122 (priA)
    USA300_FPR3757:
    04-02981:
    SA2981_1170 (priA)
    08BA02176:
    C248_1242 (priA)
    11819-97:
    MS7_1170 (priA)
    71193:
    ST398NM01_1210
    ECT-R 2:
    ECTR2_1068 (priA)
    ED133:
    SAOV_1215
    ED98:
    SAAV_1184 (priA)
    HO 5096 0412:
    SAEMRSA15_10450 (priA)
    JH1:
    SaurJH1_1296
    JH9:
    SaurJH9_1271
    JKD6008:
    SAA6008_01167 (priA)
    JKD6159:
    SAA6159_01065 (priA)
    LGA251:
    SARLGA251_11230 (priA)
    M013:
    M013TW_1150
    MRSA252:
    SAR1188 (priA)
    MSHR1132:
    SAMSHR1132_10530
    MSSA476:
    SAS1146
    Mu3:
    SAHV_1202 (priA)
    Mu50:
    SAV1212 (priA)
    MW2:
    MW1095 (priA)
    RF122:
    SAB1076 (priA)
    ST398:
    SAPIG1210
    T0131:
    SAT0131_01261 (moaC)
    TCH60:
    HMPREF0772_12020 (priA)
    TW20:
    SATW20_12060 (priA)
    USA300_TCH1516:
    USA300HOU_1150 (priA)
    VC40:
    SAVC_05225

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIAKVIVDVASKSVDYKFDYIIPEQLESVIQPGVRVIVPFGPRTIQGYVMEVTAEPDAQL
    N315            MIAKVIVDVASKSVDYKFDYIIPEQLESVIQPGVRVIVPFGPRTIQGYVMEVTAEPDAQL
    NCTC8325        MIAKVIVDVASKSVDYKFDYIIPEQLESVIQPGVRVIVPFGPRTIQGYVMEVTAEPDAQL
    Newman          MIAKVIVDVASKSVDYKFDYIIPEQLESVIQPGVRVIVPFGPRTIQGYVMEVTAEPDAQL
    USA300_FPR3757  MIAKVIVDVASKSVDYKFDYIIPEQLESVIQPGVRVIVPFGPRTIQGYVMEVTAEPDAQL
                    ************************************************************

    COL             DVSKLKKIIEVKDIQPELTSELIALSEWMGSTHVIKRISMLEVMLPSAIKAKYKKAFKMK
    N315            DVSKLKKIIEVKDIQPELTSELIALSEWMGSTHVIKRISMLEVMLPSAIKAKYKKAFKMK
    NCTC8325        DVSKLKKIIEVKDIQPELTSELIALSEWMGSTHVIKRISMLEVMLPSAIKAKYKKAFKMK
    Newman          DVSKLKKIIEVKDIQPELTSELIALSEWMGSTHVIKRISMLEVMLPSAIKAKYKKAFKMK
    USA300_FPR3757  DVSKLKKIIEVKDIQPELTSELIALSEWMGSTHVIKRISMLEVMLPSAIKAKYKKAFKMK
                    ************************************************************

    COL             DDIELPSALLQKFDKHGYYYYKDAQKNNDIQLLMKLLKDDIVEEKTILTQNITKKTKRAV
    N315            DDIELPSALLQKFDKHGYYYYKDAQKNNDIQLLMKLLKDDIVEEKTILTQNITKKTKRAV
    NCTC8325        DDIELPSALLQKFDKHGYYYYKDAQKNNDIQLLMKLLKDDIVEEKTILTQNITKKTKRAV
    Newman          DDIELPSALLQKFDKHGYYYYKDAQKNNDIQLLMKLLKDDIVEEKTILTQNITKKTKRAV
    USA300_FPR3757  DDIELPSALLQKFDKHGYYYYKDAQKNNDIQLLMKLLKDDIVEEKTILTQNITKKTKRAV
                    ************************************************************

    COL             RVIEGYHPDEVLAKLEKVIKQYDLYAYLSEEQHKTIFLTDIEDMGFSKSSLDGLIKKGYV
    N315            RVIEGYHPDEVLAKLEKVIKQYDLYAYLSEEQHKTIFLTDIEDMGFSKSSLDGLIKKGYV
    NCTC8325        RVIEGYHPDEVLAKLEKVIKQYDLYAYLSEEQHKTIFLTDIEDMGFSKSSLDGLIKKGYV
    Newman          RVIEGYHPDEVLAKLEKVIKQYDLYAYLSEEQHKTIFLTDIEDMGFSKSSLDGLIKKGYV
    USA300_FPR3757  RVIEGYHPDEVLAKLEKVIKQYDLYAYLSEEQHKTIFLTDIEDMGFSKSSLDGLIKKGYV
                    ************************************************************

    COL             EKYDAVVERDPFKDRVFEQESKQQLTEDQYKAYEAIKAKIVSQEQETFLLHGVTGSGKTE
    N315            EKYDAVVERDPFKDRVFEQESKQQLTEDQYKAYEAIKAKIVSQEQETFLLHGVTGSGKTE
    NCTC8325        EKYDAVVERDPFKDRVFEQESKQQLTEDQYKAYEAIKAKIVSQEQETFLLHGVTGSGKTE
    Newman          EKYDAVVERDPFKDRVFEQESKQQLTEDQYKAYEAIKAKIVSQEQETFLLHGVTGSGKTE
    USA300_FPR3757  EKYDAVVERDPFKDRVFEQESKQQLTEDQYKAYEAIKAKIVSQEQETFLLHGVTGSGKTE
                    ************************************************************

    COL             VYLQTIEDVLSQGKQAMMLVPEIALTPQMVLRFKRRFGDDVAVLHSGLSNGERYDEWQKI
    N315            VYLQTIEDVLSQGKQAMMLVPEIALTPQMVLRFKRRFGDDVAVLHSGLSNGERYDEWQKI
    NCTC8325        VYLQTIEDVLSQGKQAMMLVPEIALTPQMVLRFKRRFGDDVAVLHSGLSNGERYDEWQKI
    Newman          VYLQTIEDVLSQGKQAMMLVPEIALTPQMVLRFKRRFGDDVAVLHSGLSNGERYDEWQKI
    USA300_FPR3757  VYLQTIEDVLSQGKQAMMLVPEIALTPQMVLRFKRRFGDDVAVLHSGLSNGERYDEWQKI
                    ************************************************************

    COL             RDGRARVSVGARSSVFAPFKNLGLIIIDEEHESTYKQEDYPRYHAREIAQWRSEYHHCPV
    N315            RDDRARVSVGARSSVFAPFKNLGLIIIDEEHESTYKQEDYPRYHAREIAQWRSEYHHCPV
    NCTC8325        RDGRARVSVGARSSVFAPFKNLGLIIIDEEHESTYKQEDYPRYHAREIAQWRSEYHHCPV
    Newman          RDGRARVSVGARSSVFAPFKNLGLIIIDEEHESTYKQEDYPRYHAREIAQWRSEYHHCPV
    USA300_FPR3757  RDGRARVSVGARSSVFAPFKNLGLIIIDEEHESTYKQEDYPRYHAREIAQWRSEYHHCPV
                    **.*********************************************************

    COL             ILGSATPCLESYARAEKGVYHLLSLPNRVNQQALPEIDIVDMREELSEGNRSMFSKDLRE
    N315            ILGSATPCLESYARAEKDVYHLLSLPNRVNQQALPEIDIVDMREELSEGNRSMFSKDLRE
    NCTC8325        ILGSATPCLESYARAEKGVYHLLSLPNRVNQQALPEIDIVDMREELSEGNRSMFSKDLRE
    Newman          ILGSATPCLESYARAEKGVYHLLSLPNRVNQQALPEIDIVDMREELSEGNRSMFSKDLRE
    USA300_FPR3757  ILGSATPCLESYARAEKGVYHLLSLPNRVNQQALPEIDIVDMREELSEGNRSMFSKDLRE
                    *****************.******************************************

    COL             AIQLRLDRQEQVVLFLNRRGYASFMLCRDCGYVPQCPNCDISLTYHKTTDLLKCHYCGYQ
    N315            AIQLRLDRQEQVVLFLNRRGYASFMLCRDCGYVPQCPNCDISLTYHKTTDLLKCHYCGYQ
    NCTC8325        AIQLRLDRQEQVVLFLNRRGYASFMLCRDCGYVPQCPNCDISLTYHKTTDLLKCHYCGYQ
    Newman          AIQLRLDRQEQVVLFLNRRGYASFMLCRDCGYVPQCPNCDISLTYHKTTDLLKCHYCGYQ
    USA300_FPR3757  AIQLRLDRQEQVVLFLNRRGYASFMLCRDCGYVPQCPNCDISLTYHKTTDLLKCHYCGYQ
                    ************************************************************

    COL             ETPPNQCPNCESEHIRQVGTGTQKVEELLQQEFEDARIIRMDVDTTSKKGAHEKLLTEFE
    N315            ETPPNQCPNCESEHIRQVGTGTQKVEELLQQEFEDARIIRMDVDTTSKKGAHEKLLTEFE
    NCTC8325        ETPPNQCPNCESEHIRQVGTGTQKVEELLQQEFEDARIIRMDVDTTSKKGAHEKLLTEFE
    Newman          ETPPNQCPNCESEHIRQVGTGTQKVEELLQQEFEDARIIRMDVDTTSKKGAHEKLLTEFE
    USA300_FPR3757  ETPPNQCPNCESEHIRQVGTGTQKVEELLQQEFEDARIIRMDVDTTSKKGAHEKLLTEFE
                    ************************************************************

    COL             KGNGDILLGTQMIAKGLDYPNITLVGVLNADTMLNLPDFRASERTYQLLTQVAGRAGRHE
    N315            KGNGDILLGTQMIAKGLDYPNITLVGVLNADTMLNLPDFRASERTYQLLTQVAGRAGRHE
    NCTC8325        KGNGDILLGTQMIAKGLDYPNITLVGVLNADTMLNLPDFRASERTYQLLTQVAGRAGRHE
    Newman          KGNGDILLGTQMIAKGLDYPNITLVGVLNADTMLNLPDFRASERTYQLLTQVAGRAGRHE
    USA300_FPR3757  KGNGDILLGTQMIAKGLDYPNITLVGVLNADTMLNLPDFRASERTYQLLTQVAGRAGRHE
                    ************************************************************

    COL             KAGQVIIQTYNPDHYSILDVQKNDYLTFYRQEMEYRKLGKYPPYYYLINFTISHKEMKKV
    N315            KAGQVIIQTYNPDHYSILDVQKNDYLTFYRQEMEYRKLGKYPPYYYLINFTISHKEMKKV
    NCTC8325        KAGQVIIQTYNPDHYSILDVQKNDYLTFYRQEMEYRKLGKYPPYYYLINFTISHKEMKKV
    Newman          KAGQVIIQTYNPDHYSILDVQKNDYLTFYRQEMEYRKLGKYPPYYYLINFTISHKEMKKV
    USA300_FPR3757  KAGQVIIQTYNPDHYSILDVQKNDYLTFYRQEMEYRKLGKYPPYYYLINFTISHKEMKKV
                    ************************************************************

    COL             MVASQHVHKILLQHLTEKALVLGPSPAALARINNEFRFQILVKYKSEPGLLQAIQFLDDY
    N315            MEASQHVHKILLQHLTEKALVLGPSPAALARINNEFRFQILVKYKSEPGLLQAIQFLDDY
    NCTC8325        MVASQHVHKILLQHLTEKALVLGPSPAALARINNEFRFQILVKYKSEPGLLQAIQFLDDY
    Newman          MVASQHVHKILLQHLTEKALVLGPSPAALARINNEFRFQILVKYKSEPGLLQAIQFLDDY
    USA300_FPR3757  MVASQHVHKILLQHLTEKALVLGPSPAALARINNEFRFQILVKYKSEPGLLQAIQFLDDY
                    * **********************************************************

    COL             YHEKFIKEKLALKIDIDPQMMM
    N315            YHEKFIKEKLALKIDIDPQMMM
    NCTC8325        YHEKFIKEKLALKIDIDPQMMM
    Newman          YHEKFIKEKLALKIDIDPQMMM
    USA300_FPR3757  YHEKFIKEKLALKIDIDPQMMM
                    **********************