From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003497000
  • symbol?:
  • description?: membrane spanning protein

      descriptions from strain specific annotations:

    • membrane spanning protein
    • TM2 domain containing membrane protein+B7201
    • TM2 domain-containing protein
    • TM2 domain containing protein+B7201
  • strand?: -
  • coordinates?: 3837569..3837772
  • synteny block?: BlockID0025760
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1172
    08BA02176:
    C248_1244
    11819-97:
    MS7_1172
    71193:
    ST398NM01_1213
    ECT-R 2:
    ECTR2_1070
    ED133:
    SAOV_1217c
    ED98:
    SAAV_1186
    HO 5096 0412:
    SAEMRSA15_10470
    JH1:
    SaurJH1_1298
    JH9:
    SaurJH9_1273
    JKD6008:
    SAA6008_01169 (xynA)
    JKD6159:
    SAA6159_01067 (xynA)
    LGA251:
    SARLGA251_11250
    M013:
    M013TW_1152
    MRSA252:
    SAR1190
    MSHR1132:
    SAMSHR1132_10550
    MSSA476:
    SAS1148
    Mu3:
    SAHV_1204
    Mu50:
    SAV1214
    MW2:
    MW1097
    RF122:
    SAB1078c
    ST398:
    SAPIG1213
    T0131:
    SAT0131_01263
    TCH60:
    HMPREF0772_12018
    TW20:
    SATW20_12080
    USA300_TCH1516:
    VC40:
    SAVC_05235

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFELKVGIIKREANVIISNSTGGKEMQVNKVIYILLALFLGSFGIHKFYAGKNMQGILHL
    N315            -------------------------MQVNKVIYILLALFLGSFGIHKFYAGKNMQGILHL
    NCTC8325        MFELKVGIIKREANVIISNSTGGKEMQVNKVIYILLALFLGSFGIHKFYAGKNMQGILHL
    Newman          -------------------------MQVNKVIYILLALFLGSFGIHKFYAGKNMQGILHL
    USA300_FPR3757  MFELKVGIIKREANVIISNSTGGKEMQVNKVIYILLALFLGSFGIHKFYAGKNMQGILHL
                                             ***********************************

    COL             IFCWTGIPHILAIISAVITVFKPADEQGNVTL
    N315            IFCWTGIPHILAIISAVITVFKPADEQGNVTL
    NCTC8325        IFCWTGIPHILAIISAVITVFKPADEQGNVTL
    Newman          IFCWTGIPHILAIISAVITVFKPADEQGNVTL
    USA300_FPR3757  IFCWTGIPHILAIISAVITVFKPADEQGNVTL
                    ********************************