From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003507000
  • symbol?: rpmB
  • description?: 50S ribosomal protein L28
  • strand?: -
  • coordinates?: 3847581..3847769
  • synteny block?: BlockID0025860
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1238 (rpmB)
    N315:
    SA1067 (rpmB)
    NCTC8325:
    Newman:
    NWMN_1134 (rpmB)
    USA300_FPR3757:
    04-02981:
    SA2981_1182 (rpmB)
    08BA02176:
    C248_1254 (rpmB)
    11819-97:
    MS7_1182 (rpmB)
    71193:
    ST398NM01_1223
    ECT-R 2:
    ECTR2_1080 (rpmB)
    ED133:
    SAOV_1227c (rpmB)
    ED98:
    SAAV_1196 (rpmB)
    HO 5096 0412:
    SAEMRSA15_10570 (rpmB)
    JH1:
    SaurJH1_1308 (rpmB)
    JH9:
    SaurJH9_1283 (rpmB)
    JKD6008:
    SAA6008_01179 (rpmB)
    JKD6159:
    SAA6159_01077 (rpmB)
    LGA251:
    SARLGA251_11350 (rpmB)
    M013:
    M013TW_1162
    MRSA252:
    SAR1200 (rpmB)
    MSHR1132:
    SAMSHR1132_10650
    MSSA476:
    SAS1158 (rpmB)
    Mu3:
    SAHV_1214 (rpmB)
    Mu50:
    SAV1224 (rpmB)
    MW2:
    MW1107 (rpmB)
    RF122:
    SAB1088c (rpmB)
    ST398:
    SAPIG1223 (rpmB)
    T0131:
    SAT0131_01273
    TCH60:
    HMPREF0772_12008 (rpmB)
    TW20:
    SATW20_12180 (rpmB)
    USA300_TCH1516:
    VC40:
    SAVC_05285 (rpmB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGKQCFVTGRKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSARALKSGKVT
    N315            MGKQCFVTGRKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSARALKSGKVT
    NCTC8325        MGKQCFVTGRKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSARALKSGKVT
    Newman          MGKQCFVTGRKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSARALKSGKVT
    USA300_FPR3757  MGKQCFVTGRKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSARALKSGKVT
                    ************************************************************

    COL             RV
    N315            RV
    NCTC8325        RV
    Newman          RV
    USA300_FPR3757  RV
                    **