From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003515000
  • symbol?: fabG
  • description?: beta-ketoacyl-ACP reductase

      descriptions from strain specific annotations:

    • beta-ketoacyl-ACP reductase
    • 3-oxoacyl-ACP reductase
    • 3-oxoacyl-(acyl-carrier-protein) reductase
    • 3-oxoacyl-[acyl-carrier protein] reductase
    • 3-oxoacyl-#acyl-carrier protein reductase
    • 3-oxoacyl- reductase (acyl-carrier protein)
  • strand?: +
  • coordinates?: 3855398..3856138
  • synteny block?: BlockID0025940
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1245 (fabG1)
    N315:
    SA1074 (fabG)
    NCTC8325:
    Newman:
    NWMN_1141 (fabG)
    USA300_FPR3757:
    04-02981:
    SA2981_1189 (fabG)
    08BA02176:
    C248_1261 (fabG)
    11819-97:
    MS7_1189 (fabG)
    71193:
    ST398NM01_1230
    ECT-R 2:
    ECTR2_1087 (fabG)
    ED133:
    SAOV_1234
    ED98:
    SAAV_1203 (fabG1)
    HO 5096 0412:
    SAEMRSA15_10640 (fabG)
    JH1:
    SaurJH1_1315
    JH9:
    SaurJH9_1290
    JKD6008:
    SAA6008_01186 (fabG)
    JKD6159:
    SAA6159_01084 (fabG)
    LGA251:
    SARLGA251_11420 (fabG)
    M013:
    M013TW_1169
    MRSA252:
    SAR1207 (fabG)
    MSHR1132:
    SAMSHR1132_10720
    MSSA476:
    SAS1165
    Mu3:
    SAHV_1221 (fabG)
    Mu50:
    SAV1231 (fabG)
    MW2:
    MW1114 (fabG)
    RF122:
    SAB1095 (fabG)
    ST398:
    SAPIG1230 (fabG)
    T0131:
    SAT0131_01281 (ureF)
    TCH60:
    HMPREF0772_12001 (fabG2)
    TW20:
    SATW20_12250 (fabG)
    USA300_TCH1516:
    USA300HOU_1167 (fabG)
    VC40:
    SAVC_05320

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQ
    N315            MKMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQ
    NCTC8325        --MTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQ
    Newman          --MTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQ
    USA300_FPR3757  --MTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQ
                      **********************************************************

    COL             ANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNC
    N315            ANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNC
    NCTC8325        ANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNC
    Newman          ANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNC
    USA300_FPR3757  ANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNC
                    ************************************************************

    COL             IQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVN
    N315            IQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVN
    NCTC8325        IQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVN
    Newman          IQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVN
    USA300_FPR3757  IQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVN
                    ************************************************************

    COL             AVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHV
    N315            AVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHV
    NCTC8325        AVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHV
    Newman          AVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHV
    USA300_FPR3757  AVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHV
                    ************************************************************

    COL             NGGMYM
    N315            NGGMYM
    NCTC8325        NGGMYM
    Newman          NGGMYM
    USA300_FPR3757  NGGMYM
                    ******