From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003519000
  • symbol?: acpP
  • description?: acyl carrier protein

      descriptions from strain specific annotations:

    • acyl carrier protein
    • acyl carrier protein / HmrB protein
    • Acyl carrier protein / HmrB protein involved in methicillin resistance
  • strand?: +
  • coordinates?: 3857334..3857567
  • synteny block?: BlockID0025980
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1247 (acpP)
    N315:
    SA1075 (acpP)
    NCTC8325:
    Newman:
    NWMN_1142 (acpP)
    USA300_FPR3757:
    04-02981:
    SA2981_1190 (hmrB)
    08BA02176:
    C248_1263 (acpP)
    11819-97:
    MS7_1190 (acpP)
    71193:
    ST398NM01_1232
    ECT-R 2:
    ECTR2_1088 (acpP)
    ED133:
    SAOV_1235
    ED98:
    SAAV_1205 (acpP)
    HO 5096 0412:
    SAEMRSA15_10650 (acpP)
    JH1:
    SaurJH1_1316 (acpP)
    JH9:
    SaurJH9_1291 (acpP)
    JKD6008:
    SAA6008_01187 (acpP)
    JKD6159:
    SAA6159_01085 (acpP)
    LGA251:
    SARLGA251_11430 (acpP)
    M013:
    M013TW_1170
    MRSA252:
    SAR1208 (acpP)
    MSHR1132:
    SAMSHR1132_10730
    MSSA476:
    SAS1166 (acpP)
    Mu3:
    SAHV_1222 (acpP)
    Mu50:
    SAV1232 (acpP)
    MW2:
    MW1115 (acpP)
    RF122:
    SAB1096 (acpP)
    ST398:
    SAPIG1232 (acpP)
    T0131:
    SAT0131_01282 (ureG)
    TCH60:
    HMPREF0772_11999 (acpP)
    TW20:
    SATW20_12260 (acpP)
    USA300_TCH1516:
    USA300HOU_1169 (acpP)
    VC40:
    SAVC_05325 (acpP)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE
    N315            MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE
    NCTC8325        MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE
    Newman          MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE
    USA300_FPR3757  MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE
                    ************************************************************

    COL             KINTVGDAVKFINSLEK
    N315            KINTVGDAVKFINSLEK
    NCTC8325        KINTVGDAVKFINSLEK
    Newman          KINTVGDAVKFINSLEK
    USA300_FPR3757  KINTVGDAVKFINSLEK
                    *****************