From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003521000
  • symbol?: smc
  • description?: chromosome segregation protein SMC

      descriptions from strain specific annotations:

    • chromosome segregation protein SMC
    • SMC domain-containing protein
    • chromosome segregation SMC protein
    • Chromosome partition protein smc
    • chromosome partition protein
    • chromosome segregation SMC protein, putative
    • putative chromosome partition protein
    • SMC family domain protein
    • SMC superfamily ATP-binding chromosome segregation protein
  • strand?: +
  • coordinates?: 3858565..3862131
  • synteny block?: BlockID0026000
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1077 (smc)
    NCTC8325:
    Newman:
    NWMN_1144 (smc)
    USA300_FPR3757:
    04-02981:
    SA2981_1192 (smc)
    08BA02176:
    C248_1265 (smc)
    11819-97:
    MS7_1192 (smc)
    71193:
    ST398NM01_1234
    ECT-R 2:
    ECTR2_1090 (smc)
    ED133:
    SAOV_1237
    ED98:
    SAAV_1207
    HO 5096 0412:
    SAEMRSA15_10670
    JH1:
    SaurJH1_1318
    JH9:
    SaurJH9_1293
    JKD6008:
    SAA6008_01189 (smc)
    JKD6159:
    SAA6159_01087 (smc)
    LGA251:
    SARLGA251_11450
    M013:
    M013TW_1172
    MRSA252:
    SAR1210
    MSHR1132:
    SAMSHR1132_10750
    MSSA476:
    SAS1168
    Mu3:
    SAHV_1224 (smc)
    Mu50:
    SAV1234 (smc)
    MW2:
    MW1117 (smc)
    RF122:
    SAB1098
    ST398:
    SAPIG1234 (smc)
    T0131:
    SAT0131_01284 (sarR)
    TCH60:
    HMPREF0772_11997
    TW20:
    SATW20_12280
    USA300_TCH1516:
    USA300HOU_1171 (smc)
    VC40:
    SAVC_05335

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVYLKSIDAIGFKSFADQTNVQFDKGVTAIVGPNGSGKSNITDAIKWVLGEQSAKSLRGS
    N315            MVYLKSIDAIGFKSFADQTNVQFDKGVTAIVGPNGSGKSNITDAIKWVLGEQSAKSLRGS
    NCTC8325        MVYLKSIDAIGFKSFADQTNVQFDKGVTAIVGPNGSGKSNITDAIKWVLGEQSAKSLRGS
    Newman          MVYLKSIDAIGFKSFADQTNVQFDKGVTAIVGPNGSGKSNITDAIKWVLGEQSAKSLRGS
    USA300_FPR3757  MVYLKSIDAIGFKSFADQTNVQFDKGVTAIVGPNGSGKSNITDAIKWVLGEQSAKSLRGS
                    ************************************************************

    COL             KMEDIIFSGAEHRKAQNYAEVQLRLDNHSKKLSVDENEVIVTRRLYRSGESEYYINNDRA
    N315            KMEDIIFSGAEHRKAQNYAEVQLRLDNHSKKLSVDENEVIVTRRLYRSGESEYYINNDRA
    NCTC8325        KMEDIIFSGAEHRKAQNYAEVQLRLDNHSKKLSVDENEVIVTRRLYRSGESEYYINNDRA
    Newman          KMEDIIFSGAEHRKAQNYAEVQLRLDNHSKKLSVDENEVIVTRRLYRSGESEYYINNDRA
    USA300_FPR3757  KMEDIIFSGAEHRKAQNYAEVQLRLDNHSKKLSVDENEVIVTRRLYRSGESEYYINNDRA
                    ************************************************************

    COL             RLKDIADLFLDSGLGKEAYSIISQGRVDEILNAKPIDRRQIIEESAGVLKYKKRKAESLN
    N315            RLKDIADLFLDSGLGKEAYSIISQGRVDEILNAKPIDRRQIIEESAGVLKYKKRKAESLN
    NCTC8325        RLKDIADLFLDSGLGKEAYSIISQGRVDEILNAKPIDRRQIIEESAGVLKYKKRKAESLN
    Newman          RLKDIADLFLDSGLGKEAYSIISQGRVDEILNAKPIDRRQIIEESAGVLKYKKRKAESLN
    USA300_FPR3757  RLKDIADLFLDSGLGKEAYSIISQGRVDEILNAKPIDRRQIIEESAGVLKYKKRKAESLN
                    ************************************************************

    COL             KLDQTEDNLTRVEDILYDLEGRVEPLKEEAAIAKEYKTLSHQMKHSDIVVTVHDIDQYTN
    N315            KLDQTEDNLTRVEDILYDLEGRVEPLKEEAAIAKEYKTLSHQMKHSDIVVTVHDIDQYTN
    NCTC8325        KLDQTEDNLTRVEDILYDLEGRVEPLKEEAAIAKEYKTLSHQMKHSDIVVTVHDIDQYTN
    Newman          KLDQTEDNLTRVEDILYDLEGRVEPLKEEAAIAKEYKTLSHQMKHSDIVVTVHDIDQYTN
    USA300_FPR3757  KLDQTEDNLTRVEDILYDLEGRVEPLKEEAAIAKEYKTLSHQMKHSDIVVTVHDIDQYTN
                    ************************************************************

    COL             DNRQLDQRLNDLQGQQANKEADKQRLSQQIQQYKGKRHQLDNDVESLNYQLVKATEAFEK
    N315            DNRQLDQRLNDLQGQQANKEADKQRLSQQIQQYKGKRHQLDNDVESLNYQLVKATEAFEK
    NCTC8325        DNRQLDQRLNDLQGQQANKEADKQRLSQQIQQYKGKRHQLDNDVESLNYQLVKATEAFEK
    Newman          DNRQLDQRLNDLQGQQANKEADKQRLSQQIQQYKGKRHQLDNDVESLNYQLVKATEAFEK
    USA300_FPR3757  DNRQLDQRLNDLQGQQANKEADKQRLSQQIQQYKGKRHQLDNDVESLNYQLVKATEAFEK
                    ************************************************************

    COL             YTGQLNVLEERKKNQSETNARYEEEQENLMELLENISNEISEAQDTYKSLKSKQKELNAV
    N315            YTGQLNVLEERKKNQSETNARYEEEQENLMELLENISNEISEAQDTYKSLKSKQKELNAV
    NCTC8325        YTGQLNVLEERKKNQSETNARYEEEQENLMELLENISNEISEAQDTYKSLKSKQKELNAV
    Newman          YTGQLNVLEERKKNQSETNARYEEEQENLMELLENISNEISEAQDTYKSLKSKQKELNAV
    USA300_FPR3757  YTGQLNVLEERKKNQSETNARYEEEQENLMELLENISNEISEAQDTYKSLKSKQKELNAV
                    ************************************************************

    COL             IRELEEQLYVSDEAHDEKLEEIKNEYYTLMSEQSDVNNDIRFLKHTIEENEAKKSRLDSR
    N315            IRELEEQLYVSDEAHDEKLEEIKNEYYTLMSEQSDVNNDIRFLKHTIEENEAKKSRLDSR
    NCTC8325        IRELEEQLYVSDEAHDEKLEEIKNEYYTLMSEQSDVNNDIRFLKHTIEENEAKKSRLDSR
    Newman          IRELEEQLYVSDEAHDEKLEEIKNEYYTLMSEQSDVNNDIRFLKHTIEENEAKKSRLDSR
    USA300_FPR3757  IRELEEQLYVSDEAHDEKLEEIKNEYYTLMSEQSDVNNDIRFLKHTIEENEAKKSRLDSR
                    ************************************************************

    COL             LVEVFEQLKDIQGQIKTTKKEYQQTNKELSAVDKEIKNIEKDLTDTKKAQNEYEEKLYQA
    N315            LVEVFEQLKDIQGQIKTTKKEYQQTNKELSAVDKEIKNIEKDLTDTKKAQNEYEEKLYQA
    NCTC8325        LVEVFEQLKDIQGQIKTTKKEYQQTNKELSAVDKEIKNIEKDLTDTKKAQNEYEEKLYQA
    Newman          LVEVFEQLKDIQGQIKTTKKEYQQTNKELSAVDKEIKNIEKDLTDTKKAQNEYEEKLYQA
    USA300_FPR3757  LVEVFEQLKDIQGQIKTTKKEYQQTNKELSAVDKEIKNIEKDLTDTKKAQNEYEEKLYQA
                    ************************************************************

    COL             YRYTEKMKTRIDSLATQEEEYTYFFNGVKHILKAKNKELKGIYGAVAEIIDVPSKLTQAI
    N315            YRYTEKMKTRIDSLATQEEEYTYFFNGVKHILKAKNKELKGIHGAVAEIIDVPSKLTQAI
    NCTC8325        YRYTEKMKTRIDSLATQEEEYTYFFNGVKHILKAKNKELKGIYGAVAEIIDVPSKLTQAI
    Newman          YRYTEKMKTRIDSLATQEEEYTYFFNGVKHILKAKNKELKGIYGAVAEIIDVPSKLTQAI
    USA300_FPR3757  YRYTEKMKTRIDSLATQEEEYTYFFNGVKHILKAKNKELKGIYGAVAEIIDVPSKLTQAI
                    ******************************************:*****************

    COL             ETALGASLQHVIVDSEKDGRQAIQFLKERNLGRATFLPLNVIQSRVVATDIKSIAKEANG
    N315            ETALGASLQHVIVDSEKDGRQAIQFLKERNLGRATFLPLNVIQSRVVATDIKSIAKEANG
    NCTC8325        ETALGASLQHVIVDSEKDGRQAIQFLKERNLGRATFLPLNVIQSRVVATDIKSIAKEANG
    Newman          ETALGASLQHVIVDSEKDGRQAIQFLKERNLGRATFLPLNVIQSRVVATDIKSIAKEANG
    USA300_FPR3757  ETALGASLQHVIVDSEKDGRQAIQFLKERNLGRATFLPLNVIQSRVVATDIKSIAKEANG
                    ************************************************************

    COL             FISIASEAVKVAPEYQNIIGNLLGNTIIVDHLKHANELARAIKYRTRIVTLEGDIVNPGG
    N315            FISIASEAVKVAPEYQNIIGNLLGNTIIVDHLKHANELARAIKYRTRIVTLEGDIVNPGG
    NCTC8325        FISIASEAVKVAPEYQNIIGNLLGNTIIVDHLKHANELARAIKYRTRIVTLEGDIVNPGG
    Newman          FISIASEAVKVAPEYQNIIGNLLGNTIIVDHLKHANELARAIKYRTRIVTLEGDIVNPGG
    USA300_FPR3757  FISIASEAVKVAPEYQNIIGNLLGNTIIVDHLKHANELARAIKYRTRIVTLEGDIVNPGG
                    ************************************************************

    COL             SMTGGGARKSKSILSQKDELTTMRHQLEDYLRQTESFEQQFKELKIKSDQLSELYFEKSQ
    N315            SMTGGGARKSKSILSQKDELTTMRHQLEDYLRQTESFEQQFKELKIKSDQLSELYFEKSQ
    NCTC8325        SMTGGGARKSKSILSQKDELTTMRHQLEDYLRQTESFEQQFKELKIKSDQLSELYFEKSQ
    Newman          SMTGGGARKSKSILSQKDELTTMRHQLEDYLRQTESFEQQFKELKIKSDQLSELYFEKSQ
    USA300_FPR3757  SMTGGGARKSKSILSQKDELTTMRHQLEDYLRQTESFEQQFKELKIKSDQLSELYFEKSQ
                    ************************************************************

    COL             KHNTLKEQVHHFEMELDRLTTQETQIKNDHEEFEFEKNDGYTSDKSRQTLSEKETYLESI
    N315            KHNTLKEQVHHFEMELDRLTTQETQIKNDHEEFEFEKNDGYTSDKSRQTLSEKETHLESI
    NCTC8325        KHNTLKEQVHHFEMELDRLTTQETQIKNDHEEFEFEKNDGYTSDKSRQTLSEKETYLESI
    Newman          KHNTLKEQVHHFEMELDRLTTQETQIKNDHEEFEFEKNDGYTSDKSRQTLSEKETYLESI
    USA300_FPR3757  KHNTLKEQVHHFEMELDRLTTQETQIKNDHEEFEFEKNDGYTSDKSRQTLSEKETYLESI
                    *******************************************************:****

    COL             KASLKRLEDEIERYTKLSKEGKESVTKTQQTLHQKQSDLAVVKERIKTQQQTIDRLNNQN
    N315            KASLKRLEDEIERYTKLSKEGKESVTKTQQTLHQKQSDLAVVKERIKTQQQTIDRLNNQS
    NCTC8325        KASLKRLEDEIERYTKLSKEGKESVTKTQQTLHQKQSDLAVVKERIKTQQQTIDRLNNQN
    Newman          KASLKRLEDEIERYTKLSKEGKESVTKTQQTLHQKQSDLAVVKERIKTQQQTIDRLNNQN
    USA300_FPR3757  KASLKRLEDEIERYTKLSKEGKESVTKTQQTLHQKQSDLAVVKERIKTQQQTIDRLNNQN
                    ***********************************************************.

    COL             QQTKHQLKDVKEKIAFFNSDEVMGEQAFQNIKDQINGQQETRTRLSDELDKLKQQRIELN
    N315            QQTKHQLKDVKEKIAFFNSDEVMGEQAFQNIKDQINGQQETRTRLSDELDKLKQQRIELN
    NCTC8325        QQTKHQLKDVKEKIAFFNSDEVMGEQAFQNIKDQINGQQETRTRLSDELDKLKQQRIELN
    Newman          QQTKHQLKDVKEKIAFFNSDEVMGEQAFQNIKDQINGQQETRTRLSDELDKLKQQRIELN
    USA300_FPR3757  QQTKHQLKDVKEKIAFFNSDEVMGEQAFQNIKDQINGQQETRTRLSDELDKLKQQRIELN
                    ************************************************************

    COL             EQIDAQEAKLQVCHQDILAIENHYQDIKAEQSKLDVLIHHAIDHLNDEYQLTVERAKSEY
    N315            EQIDAQEATLQVCHQDILAIENHYQDIKAEQSKLDVLIHHAIDHLNDEYQLTVERAKSEY
    NCTC8325        EQIDAQEAKLQVCHQDILAIENHYQDIKAEQSKLDVLIHHAIDHLNDEYQLTVERAKSEY
    Newman          EQIDAQEAKLQVCHQDILAIENHYQDIKAEQSKLDVLIHHAIDHLNDEYQLTVERAKSEY
    USA300_FPR3757  EQIDAQEAKLQVCHQDILAIENHYQDIKAEQSKLDVLIHHAIDHLNDEYQLTVERAKSEY
                    ********.***************************************************

    COL             TSDESIDALRKKVKLMKMSIDELGPVNLNAIEQFEELNERYTFLSEQRTDLRKAKETLEQ
    N315            TSDESIDALRKKVKLMKMSIDELGPVNLNAIEQFEELNERYTFLSEQRTDLRKAKETLEQ
    NCTC8325        TSDESIDALRKKVKLMKMSIDELGPVNLNAIEQFEELNERYTFLSEQRTDLRKAKETLEQ
    Newman          TSDESIDALRKKVKLMKMSIDELGPVNLNAIEQFEELNERYTFLSEQRTDLRKAKETLEQ
    USA300_FPR3757  TSDESIDALRKKVKLMKMSIDELGPVNLNAIEQFEELNERYTFLSEQRTDLRKAKETLEQ
                    ************************************************************

    COL             IISEMDQEVTERFKETFHAIQGHFTAVFKQLFGGGDAELQLTEADYLTAGIDIVVQPPGK
    N315            IISEMDQEVTERFKETFHAIQGHFTAVFKQLFGGGDAELQLTEADYLTAGIDIVVQPPGK
    NCTC8325        IISEMDQEVTERFKETFHAIQGHFTAVFKQLFGGGDAELQLTEADYLTAGIDIVVQPPGK
    Newman          IISEMDQEVTERFKETFHAIQGHFTAVFKQLFGGGDAELQLTEADYLTAGIDIVVQPPGK
    USA300_FPR3757  IISEMDQEVTERFKETFHAIQGHFTAVFKQLFGGGDAELQLTEADYLTAGIDIVVQPPGK
                    ************************************************************

    COL             KLQHLSLLSGGERALTAIALLFAILKVRSAPFVILDEVEAALDEANVIRYAKYLNELSDE
    N315            KLQHLSLLSGGERALTAIALLFAILKVRSAPFVILDEVEAALDEANVIRYAKYLNELSDE
    NCTC8325        KLQHLSLLSGGERALTAIALLFAILKVRSAPFVILDEVEAALDEANVIRYAKYLNELSDE
    Newman          KLQHLSLLSGGERALTAIALLFAILKVRSAPFVILDEVEAALDEANVIRYAKYLNELSDE
    USA300_FPR3757  KLQHLSLLSGGERALTAIALLFAILKVRSAPFVILDEVEAALDEANVIRYAKYLNELSDE
                    ************************************************************

    COL             TQFIVITHRKGTMEFADRLYGVTMQESGVTKLVSVNLNTIDDVLKEEQ
    N315            TQFIVITHRKGTMEFADRLYGVTMQESGVTKLVSVNLNTIDDVLKEEQ
    NCTC8325        TQFIVITHRKGTMEFADRLYGVTMQESGVTKLVSVNLNTIDDVLKEEQ
    Newman          TQFIVITHRKGTMEFADRLYGVTMQESGVTKLVSVNLNTIDDVLKEEQ
    USA300_FPR3757  TQFIVITHRKGTMEFADRLYGVTMQESGVTKLVSVNLNTIDDVLKEEQ
                    ************************************************