From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003523000
  • symbol?:
  • description?: DNA-binding protein

      descriptions from strain specific annotations:

    • DNA-binding protein
    • putative DNA-binding protein
    • helix-turn-helix protein, YlxM / p13 like family protein
    • protein //
    • Sec family secretory protein signal
    • Signal recognition particle associated protein
    • signal recognition particle protein
    • transcriptional regulator
  • strand?: +
  • coordinates?: 3863368..3863700
  • synteny block?: BlockID0026020
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1194
    08BA02176:
    C248_1267
    11819-97:
    MS7_1194
    71193:
    ST398NM01_1236
    ECT-R 2:
    ECTR2_1092
    ED133:
    SAOV_1239
    ED98:
    SAAV_1209
    HO 5096 0412:
    SAEMRSA15_10690
    JH1:
    SaurJH1_1320
    JH9:
    SaurJH9_1295
    JKD6008:
    SAA6008_01191
    JKD6159:
    SAA6159_01089
    LGA251:
    SARLGA251_11470
    M013:
    M013TW_1174
    MRSA252:
    SAR1212
    MSHR1132:
    SAMSHR1132_10770
    MSSA476:
    SAS1170
    Mu3:
    SAHV_1226
    Mu50:
    SAV1236
    MW2:
    MW1119
    RF122:
    SAB1100
    ST398:
    SAPIG1236
    T0131:
    SAT0131_01286 (sarY)
    TCH60:
    HMPREF0772_11995
    TW20:
    SATW20_12300
    USA300_TCH1516:
    VC40:
    SAVC_05345

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIR
    N315            MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIR
    NCTC8325        MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIR
    Newman          MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIR
    USA300_FPR3757  MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIR
                    ************************************************************

    COL             RTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE
    N315            RTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE
    NCTC8325        RTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE
    Newman          RTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE
    USA300_FPR3757  RTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE
                    **************************************************