From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003530000
  • symbol?: rplS
  • description?: 50S ribosomal protein L19
  • strand?: +
  • coordinates?: 3869107..3869457
  • synteny block?: BlockID0026080
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1257 (rplS)
    N315:
    SA1084 (rplS)
    NCTC8325:
    Newman:
    NWMN_1151 (rplS)
    USA300_FPR3757:
    04-02981:
    SA2981_1199 (rplS)
    08BA02176:
    C248_1272 (rplS)
    11819-97:
    MS7_1199 (rplS)
    71193:
    ST398NM01_1241
    ECT-R 2:
    ECTR2_1097 (rplS)
    ED133:
    SAOV_1244 (rplS)
    ED98:
    SAAV_1215 (rplS)
    HO 5096 0412:
    SAEMRSA15_10740 (rplS)
    JH1:
    SaurJH1_1325 (rplS)
    JH9:
    SaurJH9_1300 (rplS)
    JKD6008:
    SAA6008_01196 (rplS)
    JKD6159:
    SAA6159_01094 (rplS)
    LGA251:
    SARLGA251_11520 (rplS)
    M013:
    M013TW_1179
    MRSA252:
    SAR1217 (rplS)
    MSHR1132:
    SAMSHR1132_10840
    MSSA476:
    SAS1175 (rplS)
    Mu3:
    SAHV_1231 (rplS)
    Mu50:
    SAV1241 (rplS)
    MW2:
    MW1124 (rplS)
    RF122:
    SAB1105 (rplS)
    ST398:
    SAPIG1241 (rplS)
    T0131:
    SAT0131_01291
    TCH60:
    HMPREF0772_11990 (rplS)
    TW20:
    SATW20_12350 (rplS)
    USA300_TCH1516:
    VC40:
    SAVC_05370 (rplS)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNHKLIEAVTKSQLRTDLPSFRPGDTLRVHVRIIEGTRERIQVFEGVVIKRRGGGVSET
    N315            MTNHKLIEAVTKSQLRTDLPSFRPGDTLRVHVRIIEGTRERIQVFEGIVIKRRGGGVSET
    NCTC8325        MTNHKLIEAVTKSQLRTDLPSFRPGDTLRVHVRIIEGTRERIQVFEGVVIKRRGGGVSET
    Newman          MTNHKLIEAVTKSQLRTDLPSFRPGDTLRVHVRIIEGTRERIQVFEGVVIKRRGGGVSET
    USA300_FPR3757  MTNHKLIEAVTKSQLRTDLPSFRPGDTLRVHVRIIEGTRERIQVFEGVVIKRRGGGVSET
                    ***********************************************:************

    COL             FTVRKISSGVGVERTFPLHTPKIEKIEVKRRGKVRRAKLYYLRSLRGKAARIQEIR
    N315            FTVRKISSGVGVERTFPLHTPKIEKIEVKRRGKVRRAKLYYLRSLRGKAARIQEIR
    NCTC8325        FTVRKISSGVGVERTFPLHTPKIEKIEVKRRGKVRRAKLYYLRSLRGKAARIQEIR
    Newman          FTVRKISSGVGVERTFPLHTPKIEKIEVKRRGKVRRAKLYYLRSLRGKAARIQEIR
    USA300_FPR3757  FTVRKISSGVGVERTFPLHTPKIEKIEVKRRGKVRRAKLYYLRSLRGKAARIQEIR
                    ********************************************************