From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003535000
  • symbol?: rbgA
  • description?: ribosomal biogenesis GTPase

      descriptions from strain specific annotations:

    • ribosomal biogenesis GTPase
    • 50S ribosomal subunit maturation GTPase RbgA
    • GTPase YlqF
    • GTPase family
    • GTP-binding protein
    • GTPase protein
    • putative GTPase protein
    • putative GTP-binding protein
    • ribosome biogenesis GTP-binding protein YlqF
  • strand?: +
  • coordinates?: 3874639..3875523
  • synteny block?: BlockID0026120
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1260 (rbgA)
    N315:
    SA1086 (rbgA)
    NCTC8325:
    Newman:
    NWMN_1153 (rbgA)
    USA300_FPR3757:
    04-02981:
    SA2981_1201 (rbgA)
    08BA02176:
    C248_1274
    11819-97:
    MS7_1201 (ylqF)
    71193:
    ST398NM01_1243
    ECT-R 2:
    ECTR2_1099
    ED133:
    SAOV_1246
    ED98:
    SAAV_1217 (rbgA)
    HO 5096 0412:
    SAEMRSA15_10760
    JH1:
    SaurJH1_1327 (rbgA)
    JH9:
    SaurJH9_1302 (rbgA)
    JKD6008:
    SAA6008_01198 (rbgA)
    JKD6159:
    SAA6159_01098 (rbgA)
    LGA251:
    SARLGA251_11540
    M013:
    M013TW_1181
    MRSA252:
    SAR1219 (rbgA)
    MSHR1132:
    SAMSHR1132_10860
    MSSA476:
    SAS1177 (rbgA)
    Mu3:
    SAHV_1233 (rbgA)
    Mu50:
    SAV1243 (rbgA)
    MW2:
    MW1126 (rbgA)
    RF122:
    SAB1107 (rbgA)
    ST398:
    SAPIG1243
    T0131:
    SAT0131_01293
    TCH60:
    HMPREF0772_11988 (ylqF)
    TW20:
    SATW20_12370
    USA300_TCH1516:
    USA300HOU_1174 (rbgA)
    VC40:
    SAVC_05380 (rbgA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVIQWYPGHMAKAKREVSEQLKKVDVVFELVDARIPYSSRNPMIDEVINQKPRVVILNKK
    N315            MVIQWYPGHMAKAKREVSEQLKKVDVVFELVDARIPYSSRNPMIDEVINQKPRVVILNKK
    NCTC8325        MVIQWYPGHMAKAKREVSEQLKKVDVVFELVDARIPYSSRNPMIDEVINQKPRVVILNKK
    Newman          MVIQWYPGHMAKAKREVSEQLKKVDVVFELVDARIPYSSRNPMIDEVINQKPRVVILNKK
    USA300_FPR3757  MVIQWYPGHMAKAKREVSEQLKKVDVVFELVDARIPYSSRNPMIDEVINQKPRVVILNKK
                    ************************************************************

    COL             DMSNLNEMSKWEQFFIDKGYYPVSVDAKHGKNLKKVEAAAIKATAEKFEREKAKGLKPRA
    N315            DMSNLNEMSKWEQFFIDKGYYPVSVDAKHGKNLKKVEAAAIKATAEKFEREKAKGLKPRA
    NCTC8325        DMSNLNEMSKWEQFFIDKGYYPVSVDAKHGKNLKKVEAAAIKATAEKFEREKAKGLKPRA
    Newman          DMSNLNEMSKWEQFFIDKGYYPVSVDAKHGKNLKKVEAAAIKATAEKFEREKAKGLKPRA
    USA300_FPR3757  DMSNLNEMSKWEQFFIDKGYYPVSVDAKHGKNLKKVEAAAIKATAEKFEREKAKGLKPRA
                    ************************************************************

    COL             IRAMIVGIPNVGKSTLINKLAKRSIAQTGNKPGVTKQQQWIKVGNALQLLDTPGILWPKF
    N315            IRAMIVGIPNVGKSTLINKLAKRSIAQTGNKPGVTKQQQWIKVSNALQLLDTPGILWPKF
    NCTC8325        IRAMIVGIPNVGKSTLINKLAKRSIAQTGNKPGVTKQQQWIKVGNALQLLDTPGILWPKF
    Newman          IRAMIVGIPNVGKSTLINKLAKRSIAQTGNKPGVTKQQQWIKVGNALQLLDTPGILWPKF
    USA300_FPR3757  IRAMIVGIPNVGKSTLINKLAKRSIAQTGNKPGVTKQQQWIKVGNALQLLDTPGILWPKF
                    *******************************************.****************

    COL             EDEEVGKKLSLTGAIKDSIVHLDEVAIYGLNFLIQNDLARLKSHYNIEVPEDAEIIAWFD
    N315            EDEEVGKKLSLTGAIKDSIVHLDEVAIYGLNFLIQNDLARLKSHYNIEVPEDAEIIAWFD
    NCTC8325        EDEEVGKKLSLTGAIKDSIVHLDEVAIYGLNFLIQNDLARLKSHYNIEVPEDAEIIAWFD
    Newman          EDEEVGKKLSLTGAIKDSIVHLDEVAIYGLNFLIQNDLARLKSHYNIEVPEDAEIIAWFD
    USA300_FPR3757  EDEEVGKKLSLTGAIKDSIVHLDEVAIYGLNFLIQNDLARLKSHYNIEVPEDAEIIAWFD
                    ************************************************************

    COL             AIGKKRGLIRRGNEIDYEAVIELIIYDIRNAKIGNYCFDIFKDMTEELANDANN
    N315            AIGKKRGLIRRGNEIDYEAVIELIIYDIRNAKIGNYCFDIFKDMTEELANDANN
    NCTC8325        AIGKKRGLIRRGNEIDYEAVIELIIYDIRNAKIGNYCFDIFKDMTEELANDANN
    Newman          AIGKKRGLIRRGNEIDYEAVIELIIYDIRNAKIGNYCFDIFKDMTEELANDANN
    USA300_FPR3757  AIGKKRGLIRRGNEIDYEAVIELIIYDIRNAKIGNYCFDIFKDMTEELANDANN
                    ******************************************************