From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003542000
  • symbol?: fmhC
  • description?: aminoacyltransferase

      descriptions from strain specific annotations:

    • aminoacyltransferase
    • endopeptidase resistance gene
    • FmhC protein
    • methicillin resistance-related protein FmhC
    • endopeptidase resistance protein
    • femAB family protein
    • methicillin resistance protein
    • FemAB family peptidoglycan biosynthesis protein
    • FmhC protein of FemAB family
    • pseudogene
  • strand?: +
  • coordinates?: 3879858..3880515
  • synteny block?: BlockID0026190
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1265 (eprH)
    N315:
    SA1091 (fmhC)
    NCTC8325:
    Newman:
    NWMN_1158 (fmhC)
    USA300_FPR3757:
    04-02981:
    SA2981_1206 (fmhC)
    08BA02176:
    C248_1279 (fmhC)
    11819-97:
    MS7_1206
    71193:
    ECT-R 2:
    ECTR2_1104
    ED133:
    SAOV_1250
    ED98:
    SAAV_1222 (eprH)
    HO 5096 0412:
    SAEMRSA15_10810 (fmhC)
    JH1:
    SaurJH1_1332
    JH9:
    SaurJH9_1307
    JKD6008:
    SAA6008_01203 (fmhC)
    JKD6159:
    SAA6159_01103 (fmhC)
    LGA251:
    SARLGA251_11590 (fmhC)
    M013:
    M013TW_1186
    MRSA252:
    SAR1224 (fmhC)
    MSHR1132:
    SAMSHR1132_10910
    MSSA476:
    SAS1182
    Mu3:
    SAHV_1238 (fmhC)
    Mu50:
    SAV1248 (fmhC(eprh))
    MW2:
    MW1131 (fmhC)
    RF122:
    ST398:
    T0131:
    SAT0131_01298
    TCH60:
    HMPREF0772_11983 (eprH)
    TW20:
    SATW20_12420 (fmhC)
    USA300_TCH1516:
    USA300HOU_1179 (fmhC)
    VC40:
    SAVC_05405

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFSTLSEEEFTNYTKKHFKHYTQSIELYNYRNKINHEAHIVGVKNDKNEVIAACLLTEA
    N315            MKFSTLSEEEFTNYTKKHFKHYTQSIELYNYRNKINHEAHIVGVKNDKNEVIAACLLTEA
    NCTC8325        MKFSTLSEEEFTNYTKKHFKHYTQSIELYNYRNKINHEAHIVGVKNDKNEVIAACLLTEA
    Newman          MKFSTLSEEEFTNYTKKHFKHYTQSIELYNYRNKINHEAHIVGVKNDKNEVIAACLLTEA
    USA300_FPR3757  MKFSTLSEEEFTNYTKKHFKHYTQSIELYNYRNKINHEAHIVGVKNDKNEVIAACLLTEA
                    ************************************************************

    COL             RIFKFYKYFYSHRGPLLDYFDAKLVCYFFKELSKFIYKNRGVFILVDPYLIENLRDANGR
    N315            RIFKFYKYFYSHRGPLLDYFDAKLVCYFFKELSKFIYKNRGVFILVDPYLIENLRDANGR
    NCTC8325        RIFKFYKYFYSHRGPLLDYFDAKLVCYFFKELSKFIYKNRGVFILVDPYLIENLRDANGR
    Newman          RIFKFYKYFYSHRGPLLDYFDAKLVCYFFKELSKFIYKNRGVFILVDPYLIENLRDANGR
    USA300_FPR3757  RIFKFYKYFYSHRGPLLDYFDAKLVCYFFKELSKFIYKNRGVFILVDPYLIENLRDANGR
                    ************************************************************

    COL             IIKNYNNSVIVKMLGKIGYLHQGYTTGYSNKSQIRWISVLDLKDKDENQLLKEMEYQTRR
    N315            IIKNYNNSVIVKMLGKIGYLHQGYTTGYSNKSQIRWISVLDLKDKDENQLLKEMEYQTRR
    NCTC8325        IIKNYNNSVIVKMLGKIGYLHQGYTTGYSNKSQIRWISVLDLKDKDENQLLKEMEYQTRR
    Newman          IIKNYNNSVIVKMLGKIGYLHQGYTTGYSNKSQIRWISVLDLKDKDENQLLKEMEYQTRR
    USA300_FPR3757  IIKNYNNSVIVKMLGKIGYLHQGYTTGYSNKSQIRWISVLDLKDKDENQLLKEMEYQTRR
                    ************************************************************

    COL             NIKKTIEIGVKVEDLSIEETNRFYKLFQMAEEKHGFHFMNEDYFKRMQEIYKDKAMLKIA
    N315            NIKKTIEIGVKVEDLSIEETNRFYKLFQMAEEKHGFHFMNEDYFKRMQEIYKDKAMLKIA
    NCTC8325        NIKKTIEIGVKVEDLSIEETNRFYKLFQMAEEKHGFHFMNEDYFKRMQEIYKDKAMLKIA
    Newman          NIKKTIEIGVKVEDLSIEETNRFYKLFQMAEEKHGFHFMNEDYFKRMQEIYKDKAMLKIA
    USA300_FPR3757  NIKKTIEIGVKVEDLSIEETNRFYKLFQMAEEKHGFHFMNEDYFKRMQEIYKDKAMLKIA
                    ************************************************************

    COL             CINLNEYQDKLKIQLLKIENEMMTVNRALNENPNSKKNKSKLNQLNMQLSSINNRISKTE
    N315            CINLNEYQDKLKIQLLKIENEMMTVNRALNENPNSKKNKSKLNQLNMQLSSINNRISKTE
    NCTC8325        CINLNEYQDKLKIQLLKIENEMMTVNRALNENPNSKKNKSKLNQLNMQLSSINNRISKTE
    Newman          CINLNEYQDKLKIQLLKIENEMMTVNRALNENPNSKKNKSKLNQLNMQLSSINNRISKTE
    USA300_FPR3757  CINLNEYQDKLKIQLLKIENEMMTVNRALNENPNSKKNKSKLNQLNMQLSSINNRISKTE
                    ************************************************************

    COL             ELIFEDGPVLDLAAALFICTDDEVYYLSSGSNPKYNQYMGAYHLQWHMIKYAKSHNINRY
    N315            ELILEDGPVLDLAAALFICTDDEVYYLSSGSNPKYNQYMGAYHLQWHMIKYAKSHNINRY
    NCTC8325        ELIFEDGPVLDLAAALFICTDDEVYYLSSGSNPKYNQYMGAYHLQWHMIKYAKSHNINRY
    Newman          ELIFEDGPVLDLAAALFICTDDEVYYLSSGSNPKYNQYMGAYHLQWHMIKYAKSHNINRY
    USA300_FPR3757  ELIFEDGPVLDLAAALFICTDDEVYYLSSGSNPKYNQYMGAYHLQWHMIKYAKSHNINRY
                    ***:********************************************************

    COL             NFYGITGVFSNEADDFGVQQFKKGFNAHVEELIGDFIKPVRPILYKFAKLIYKV
    N315            NFYGITGVFSNEADDFGVQQFKKGFNAHVEELIGDFIKPVRPILYKFAKLIYKV
    NCTC8325        NFYGITGVFSNEADDFGVQQFKKGFNAHVEELIGDFIKPVRPILYKFAKLIYKV
    Newman          NFYGITGVFSNEADDFGVQQFKKGFNAHVEELIGDFIKPVRPILYKFAKLIYKV
    USA300_FPR3757  NFYGITGVFSNEADDFGVQQFKKGFNAHVEELIGDFIKPVRPILYKFAKLIYKV
                    ******************************************************