From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003553000
  • symbol?: codY
  • description?: transcriptional repressor CodY

      descriptions from strain specific annotations:

    • transcriptional repressor CodY
    • CodY family transcriptional regulator
    • GTP-sensing transcriptional pleiotropic repressor codY
    • regulatory protein
    • CodY protein
    • putative regulatory protein
  • strand?: +
  • coordinates?: 3889860..3890633
  • synteny block?: BlockID0026300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1272 (codY)
    N315:
    SA1098 (codY)
    NCTC8325:
    Newman:
    NWMN_1165 (codY)
    USA300_FPR3757:
    04-02981:
    SA2981_1213 (codY)
    08BA02176:
    C248_1286 (codY)
    11819-97:
    MS7_1213 (codY)
    71193:
    ST398NM01_1257
    ECT-R 2:
    ECTR2_1111 (codY)
    ED133:
    SAOV_1257
    ED98:
    SAAV_1229 (codY)
    HO 5096 0412:
    SAEMRSA15_10880 (codY)
    JH1:
    SaurJH1_1340
    JH9:
    SaurJH9_1315
    JKD6008:
    SAA6008_01210 (codY)
    JKD6159:
    SAA6159_01110 (codY)
    LGA251:
    SARLGA251_11660 (codY)
    M013:
    M013TW_1195
    MRSA252:
    SAR1231 (codY)
    MSHR1132:
    SAMSHR1132_10980
    MSSA476:
    SAS1189
    Mu3:
    SAHV_1245 (codY)
    Mu50:
    SAV1255 (codY)
    MW2:
    MW1138 (codY)
    RF122:
    SAB1117 (codY)
    ST398:
    SAPIG1257 (codY)
    T0131:
    SAT0131_01307
    TCH60:
    HMPREF0772_11975 (codY)
    TW20:
    SATW20_12490 (codY)
    USA300_TCH1516:
    USA300HOU_1186
    VC40:
    SAVC_05440

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSLLSKTRELNTLLQKHKGIAVDFKDVAQTISSVTVTNVFIVSRRGKILGSSLNELLKSQ
    N315            MSLLSKTRELNTLLQKHKGIAVDFKDVAQTISSVTVTNVFIVSRRGKILGSSLNELLKSQ
    NCTC8325        MSLLSKTRELNTLLQKHKGIAVDFKDVAQTISSVTVTNVFIVSRRGKILGSSLNELLKSQ
    Newman          MSLLSKTRELNTLLQKHKGIAVDFKDVAQTISSVTVTNVFIVSRRGKILGSSLNELLKSQ
    USA300_FPR3757  MSLLSKTRELNTLLQKHKGIAVDFKDVAQTISSVTVTNVFIVSRRGKILGSSLNELLKSQ
                    ************************************************************

    COL             RIIQMLEERHIPSEYTERLMEVKQTESNIDIDNVLTVFPPENRELFIDSRTTIFPILGGG
    N315            RIIQMLEERHIPSEYTERLMEVKQTESNIDIDNVLTVFPPENRELFIDSRTTIFPILGGG
    NCTC8325        RIIQMLEERHIPSEYTERLMEVKQTESNIDIDNVLTVFPPENRELFIDSRTTIFPILGGG
    Newman          RIIQMLEERHIPSEYTERLMEVKQTESNIDIDNVLTVFPPENRELFIDSRTTIFPILGGG
    USA300_FPR3757  RIIQMLEERHIPSEYTERLMEVKQTESNIDIDNVLTVFPPENRELFIDSRTTIFPILGGG
                    ************************************************************

    COL             ERLGTLVLGRVHDDFNENDLVLGEYAATVIGMEILREKHSEVEKEARDKAAITMAINSLS
    N315            ERLGTLVLGRVHDDFNENDLVLGEYAATVIGMEILREKHSEVEKEARDKAAITMAINSLS
    NCTC8325        ERLGTLVLGRVHDDFNENDLVLGEYAATVIGMEILREKHSEVEKEARDKAAITMAINSLS
    Newman          ERLGTLVLGRVHDDFNENDLVLGEYAATVIGMEILREKHSEVEKEARDKAAITMAINSLS
    USA300_FPR3757  ERLGTLVLGRVHDDFNENDLVLGEYAATVIGMEILREKHSEVEKEARDKAAITMAINSLS
                    ************************************************************

    COL             YSEKEAIEHIFEELGGTEGLLIASKVADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
    N315            YSEKEAIEHIFEELGGTEGLLIASKVADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
    NCTC8325        YSEKEAIEHIFEELGGTEGLLIASKVADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
    Newman          YSEKEAIEHIFEELGGTEGLLIASKVADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
    USA300_FPR3757  YSEKEAIEHIFEELGGTEGLLIASKVADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
                    ************************************************************

    COL             FIKVKKEKFLDELEKSK
    N315            FIKVKKEKFLDELEKSK
    NCTC8325        FIKVKKEKFLDELEKSK
    Newman          FIKVKKEKFLDELEKSK
    USA300_FPR3757  FIKVKKEKFLDELEKSK
                    *****************