From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003555000
  • symbol?: rpsB
  • description?: 30S ribosomal protein S2
  • strand?: +
  • coordinates?: 3890980..3891745
  • synteny block?: BlockID0026320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1274 (rpsB)
    N315:
    SA1099 (rpsB)
    NCTC8325:
    Newman:
    NWMN_1166 (rpsB)
    USA300_FPR3757:
    04-02981:
    SA2981_1214 (rpsB)
    08BA02176:
    C248_1288 (rpsB)
    11819-97:
    MS7_1214 (rpsB)
    71193:
    ST398NM01_1258
    ECT-R 2:
    ECTR2_1112 (rpsB)
    ED133:
    SAOV_1258 (rpsB)
    ED98:
    SAAV_1230 (rpsB)
    HO 5096 0412:
    SAEMRSA15_10890 (rpsB)
    JH1:
    SaurJH1_1341 (rpsB)
    JH9:
    SaurJH9_1316 (rpsB)
    JKD6008:
    SAA6008_01211 (rpsB)
    JKD6159:
    SAA6159_01111 (rpsB)
    LGA251:
    SARLGA251_11670 (rpsB)
    M013:
    M013TW_1196
    MRSA252:
    SAR1232 (rpsB)
    MSHR1132:
    SAMSHR1132_10990
    MSSA476:
    SAS1190 (rpsB)
    Mu3:
    SAHV_1246 (rpsB)
    Mu50:
    SAV1256 (rpsB)
    MW2:
    MW1139 (rpsB)
    RF122:
    SAB1118 (rpsB)
    ST398:
    SAPIG1258 (rpsB)
    T0131:
    SAT0131_01308
    TCH60:
    HMPREF0772_11974 (rpsB)
    TW20:
    SATW20_12500 (rpsB)
    USA300_TCH1516:
    USA300HOU_1188 (rpsB)
    VC40:
    SAVC_05445 (rpsB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAVISMKQLLEAGVHFGHQTRRWNPKMKKYIFTERNGIYIIDLQKTVKKVDEAYNFLKQV
    N315            MAVISMKQLLEAGVHFGHQTRRWNPKMKKYIFTERNGIYIIDLQKTVKKVDEAYNFLKQV
    NCTC8325        MAVISMKQLLEAGVHFGHQTRRWNPKMKKYIFTERNGIYIIDLQKTVKKVDEAYNFLKQV
    Newman          MAVISMKQLLEAGVHFGHQTRRWNPKMKKYIFTERNGIYIIDLQKTVKKVDEAYNFLKQV
    USA300_FPR3757  MAVISMKQLLEAGVHFGHQTRRWNPKMKKYIFTERNGIYIIDLQKTVKKVDEAYNFLKQV
                    ************************************************************

    COL             SEDGGQVLFVGTKKQAQESVKSEAERAGQFYINQRWLGGLLTNYKTISKRIKRISEIEKM
    N315            SEDGGQVLFVGTKKQAQESVKSEAERAGQFYINQRWLGGLLTNYKTISKRIKRISEIEKM
    NCTC8325        SEDGGQVLFVGTKKQAQESVKSEAERAGQFYINQRWLGGLLTNYKTISKRIKRISEIEKM
    Newman          SEDGGQVLFVGTKKQAQESVKSEAERAGQFYINQRWLGGLLTNYKTISKRIKRISEIEKM
    USA300_FPR3757  SEDGGQVLFVGTKKQAQESVKSEAERAGQFYINQRWLGGLLTNYKTISKRIKRISEIEKM
                    ************************************************************

    COL             EEDGLFEVLPKKEVVELKKEYDRLIKFLGGIRDMKSMPQALFVVDPRKERNAIAEARKLN
    N315            EEDGLFEVLPKKEVVELKKEYDRLIKFLGGIRDMKSMPQALFVVDPRKERNAIAEARKLN
    NCTC8325        EEDGLFEVLPKKEVVELKKEYDRLIKFLGGIRDMKSMPQALFVVDPRKERNAIAEARKLN
    Newman          EEDGLFEVLPKKEVVELKKEYDRLIKFLGGIRDMKSMPQALFVVDPRKERNAIAEARKLN
    USA300_FPR3757  EEDGLFEVLPKKEVVELKKEYDRLIKFLGGIRDMKSMPQALFVVDPRKERNAIAEARKLN
                    ************************************************************

    COL             IPIVGIVDTNCDPDEIDYVIPANDDAIRAVKLLTAKMADAILEGQQGVSNEEVAAEQNID
    N315            IPIVGIVDTNCDPDEIDYVIPANDDAIRAVKLLTAKMADAILEGQQGVSNEEVAAEQNID
    NCTC8325        IPIVGIVDTNCDPDEIDYVIPANDDAIRAVKLLTAKMADAILEGQQGVSNEEVAAEQNID
    Newman          IPIVGIVDTNCDPDEIDYVIPANDDAIRAVKLLTAKMADAILEGQQGVSNEEVAAEQNID
    USA300_FPR3757  IPIVGIVDTNCDPDEIDYVIPANDDAIRAVKLLTAKMADAILEGQQGVSNEEVAAEQNID
                    ************************************************************

    COL             LDEKEKSEETEATEA
    N315            LDEKEKSEETEATEE
    NCTC8325        LDEKEKSEETEATEE
    Newman          LDEKEKSEETEATEE
    USA300_FPR3757  LDEKEKSEETEATEE
                    **************