From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003562000
  • symbol?: cdsA
  • description?: phosphatidate cytidylyltransferase

      descriptions from strain specific annotations:

    • phosphatidate cytidylyltransferase
    • putative phosphatidate cytidylyltransferase
    • cytidylyltransferase family protein
  • strand?: +
  • coordinates?: 3895412..3896194
  • synteny block?: BlockID0026390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1280 (cdsA)
    N315:
    SA1104 (cdsA)
    NCTC8325:
    Newman:
    NWMN_1171 (cdsA)
    USA300_FPR3757:
    04-02981:
    SA2981_1219 (cdsA)
    08BA02176:
    C248_1294
    11819-97:
    MS7_1219
    71193:
    ST398NM01_1263
    ECT-R 2:
    ECTR2_1117
    ED133:
    SAOV_1263
    ED98:
    SAAV_1236 (cdsA)
    HO 5096 0412:
    SAEMRSA15_10940
    JH1:
    SaurJH1_1347
    JH9:
    SaurJH9_1321
    JKD6008:
    SAA6008_01216 (cdsA)
    JKD6159:
    SAA6159_01116 (cdsA)
    LGA251:
    SARLGA251_11720
    M013:
    M013TW_1201
    MRSA252:
    SAR1237
    MSHR1132:
    SAMSHR1132_11040
    MSSA476:
    SAS1195
    Mu3:
    SAHV_1251 (cdsA)
    Mu50:
    SAV1261 (cdsA)
    MW2:
    MW1144 (cdsA)
    RF122:
    SAB1123 (cdsA)
    ST398:
    SAPIG1263 (cdsA)
    T0131:
    SAT0131_01314
    TCH60:
    HMPREF0772_11968 (cdsA)
    TW20:
    SATW20_12550
    USA300_TCH1516:
    USA300HOU_1193 (cdsA)
    VC40:
    SAVC_05470

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKVRTLTAIIALIVFLPILLKGGLVLMIFANILALIALKELLNMNMIKFVSVPGLISAVG
    N315            MKVRTLTAIIALIVFLPILLKGGLVLMIFANILALIALKELLNMNMIKFVSVPGLISAVG
    NCTC8325        MKVRTLTAIIALIVFLPILLKGGLVLMIFANILALIALKELLNMNMIKFVSVPGLISAVG
    Newman          MKVRTLTAIIALIVFLPILLKGGLVLMIFANILALIALKELLNMNMIKFVSVPGLISAVG
    USA300_FPR3757  MKVRTLTAIIALIVFLPILLKGGLVLMIFANILALIALKELLNMNMIKFVSVPGLISAVG
                    ************************************************************

    COL             LIIIMLPQHAGPWVQVIQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVGIGFM
    N315            LIIIMLPQHAGPWVQVIQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVGIGFM
    NCTC8325        LIIIMLPQHAGPWVQVIQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVGIGFM
    Newman          LIIIMLPQHAGPWVQVIQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVGIGFM
    USA300_FPR3757  LIIIMLPQHAGPWVQVIQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVGIGFM
                    ************************************************************

    COL             FFYETRSEGLHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGLFCSL
    N315            FFYETRSEGLHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGLFCSL
    NCTC8325        FFYETRSEGLHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGLFCSL
    Newman          FFYETRSEGLHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGLFCSL
    USA300_FPR3757  FFYETRSEGLHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGLFCSL
                    ************************************************************

    COL             IVPLAMLYFVDFNMNVWILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGIL
    N315            IVPLAMLYFVDFNMNVWILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGIL
    NCTC8325        IVPLAMLYFVDFNMNVWILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGIL
    Newman          IVPLAMLYFVDFNMNVWILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGIL
    USA300_FPR3757  IVPLAMLYFVDFNMNVWILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGIL
                    ************************************************************

    COL             DRFDSFMFVLPLLNILLIQS
    N315            DRFDSFMFVLPLLNILLIQS
    NCTC8325        DRFDSFMFVLPLLNILLIQS
    Newman          DRFDSFMFVLPLLNILLIQS
    USA300_FPR3757  DRFDSFMFVLPLLNILLIQS
                    ********************