From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003567000
  • symbol?: nusA
  • description?: transcription elongation factor NusA

      descriptions from strain specific annotations:

    • transcription elongation factor NusA
    • transcription termination/antitermination protein NusA
    • Transcription termination protein NusA
    • NusA antitermination factor
    • N utilization substance protein A, putative
    • putative N utilization substance protein A
    • transcription elongation protein nusA
    • transcription termination-antitermination factor
    • transcription termination factor NusA
  • strand?: +
  • coordinates?: 3904833..3906008
  • synteny block?: BlockID0026440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1285 (nusA)
    N315:
    SA1109 (nusA)
    NCTC8325:
    Newman:
    NWMN_1176 (nusA)
    USA300_FPR3757:
    04-02981:
    SA2981_1224 (nusA)
    08BA02176:
    C248_1299 (nusA)
    11819-97:
    MS7_1224 (nusA)
    71193:
    ST398NM01_1268
    ECT-R 2:
    ECTR2_1122 (nusA)
    ED133:
    SAOV_1268
    ED98:
    SAAV_1241 (nusA)
    HO 5096 0412:
    SAEMRSA15_10990 (nusA)
    JH1:
    SaurJH1_1352 (nusA)
    JH9:
    SaurJH9_1326 (nusA)
    JKD6008:
    SAA6008_01221 (nusA)
    JKD6159:
    SAA6159_01121 (nusA)
    LGA251:
    SARLGA251_11770 (nusA)
    M013:
    M013TW_1206
    MRSA252:
    SAR1242 (nusA)
    MSHR1132:
    SAMSHR1132_11090
    MSSA476:
    SAS1200 (nusA)
    Mu3:
    SAHV_1256 (nusA)
    Mu50:
    SAV1266 (nusA)
    MW2:
    MW1149 (nusA)
    RF122:
    SAB1128 (nusA)
    ST398:
    SAPIG1268 (nusA)
    T0131:
    SAT0131_01319
    TCH60:
    HMPREF0772_11963 (nusA)
    TW20:
    SATW20_12600 (nusA)
    USA300_TCH1516:
    USA300HOU_1198 (nusA)
    VC40:
    SAVC_05495 (nusA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSSNELLLATEYLEKEKKIPRAVLIDAIEAALITAYKKNYDSARNVRVELNMDQGTFKVI
    N315            MSSNELLLATEYLEKEKKIPRAVLIDAIEAALITAYKKNYDSARNVRVELNMDQGTFKVI
    NCTC8325        MSSNELLLATEYLEKEKKIPRAVLIDAIEAALITAYKKNYDSARNVRVELNMDQGTFKVI
    Newman          MSSNELLLATEYLEKEKKIPRAVLIDAIEAALITAYKKNYDSARNVRVELNMDQGTFKVI
    USA300_FPR3757  MSSNELLLATEYLEKEKKIPRAVLIDAIEAALITAYKKNYDSARNVRVELNMDQGTFKVI
                    ************************************************************

    COL             ARKDVVEEVFDDRDEVDLSTALVKNPAYEIGDIYEEDVTPKDFGRVGAQAAKQAVMQRLR
    N315            ARKDVVEEVFDDRDEVDLSTALVKNPAYEIGDIYEEDVTPKDFGRVGAQAAKQAVMQRLR
    NCTC8325        ARKDVVEEVFDDRDEVDLSTALVKNPAYEIGDIYEEDVTPKDFGRVGAQAAKQAVMQRLR
    Newman          ARKDVVEEVFDDRDEVDLSTALVKNPAYEIGDIYEEDVTPKDFGRVGAQAAKQAVMQRLR
    USA300_FPR3757  ARKDVVEEVFDDRDEVDLSTALVKNPAYEIGDIYEEDVTPKDFGRVGAQAAKQAVMQRLR
                    ************************************************************

    COL             DAEREILFEEFIDKEEDILTGIIDRVDHRYVYVNLGRIEAVLSEAERSPNEKYIPNERIK
    N315            DAEREILFEEFIDKEEDILTGIIDRVDHRYVYVNLGRIEAVLSEAERSPNEKYIPNERIK
    NCTC8325        DAEREILFEEFIDKEEDILTGIIDRVDHRYVYVNLGRIEAVLSEAERSPNEKYIPNERIK
    Newman          DAEREILFEEFIDKEEDILTGIIDRVDHRYVYVNLGRIEAVLSEAERSPNEKYIPNERIK
    USA300_FPR3757  DAEREILFEEFIDKEEDILTGIIDRVDHRYVYVNLGRIEAVLSEAERSPNEKYIPNERIK
                    ************************************************************

    COL             VYVNKVEQTTKGPQIYVSRSHPGLLKRLFEQEVPEIYDGTVIVKSVAREAGDRSKISVFS
    N315            VYVNKVEQTTKGPQIYVSRSHPGLLKRLFEQEVPEIYDGTVIVKSVAREAGDRSKISVFS
    NCTC8325        VYVNKVEQTTKGPQIYVSRSHPGLLKRLFEQEVPEIYDGTVIVKSVAREAGDRSKISVFS
    Newman          VYVNKVEQTTKGPQIYVSRSHPGLLKRLFEQEVPEIYDGTVIVKSVAREAGDRSKISVFS
    USA300_FPR3757  VYVNKVEQTTKGPQIYVSRSHPGLLKRLFEQEVPEIYDGTVIVKSVAREAGDRSKISVFS
                    ************************************************************

    COL             ENNDIDAVGACVGAKGARVEAVVEELGGEKIDIVQWNEDPKVFVKNALSPSQVLEVIVDE
    N315            ENNDIDAVGACVGAKGARVEAVVEELGGEKIDIVQWNEDPKVFVKNALSPSQVLEVIVDE
    NCTC8325        ENNDIDAVGACVGAKGARVEAVVEELGGEKIDIVQWNEDPKVFVKNALSPSQVLEVIVDE
    Newman          ENNDIDAVGACVGAKGARVEAVVEELGGEKIDIVQWNEDPKVFVKNALSPSQVLEVIVDE
    USA300_FPR3757  ENNDIDAVGACVGAKGARVEAVVEELGGEKIDIVQWNEDPKVFVKNALSPSQVLEVIVDE
                    ************************************************************

    COL             TNQSTVVVVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETDAREAGIYPVVEAEKVTE
    N315            TNQSTVVVVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETDAREAGIYPVVEAEKVTE
    NCTC8325        TNQSTVVVVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETDAREAGIYPVVEAEKVTE
    Newman          TNQSTVVVVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETDAREAGIYPVVEAEKVTE
    USA300_FPR3757  TNQSTVVVVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETDAREAGIYPVVEAEKVTE
                    ************************************************************

    COL             EDVALEDADTTESTEEVNDVSVETNVEKESE
    N315            EDIALEDADTTESTEEVNDVSVETNVEKESE
    NCTC8325        EDVALEDADTTESTEEVNDVSVETNVEKESE
    Newman          EDVALEDADTTESTEEVNDVSVETNVEKESE
    USA300_FPR3757  EDVALEDADTTESTEEVNDVSVETNVEKESE
                    **:****************************