From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003569000
  • symbol?:
  • description?: ribosomal protein L7Ae

      descriptions from strain specific annotations:

    • ribosomal protein L7Ae
    • 50S ribosomal protein L7
    • 30S ribosomal protein L7 AE
    • ribosomal protein L7AE family protein
    • 50S ribosomal protein L7/L12
    • 50S ribosomal protein L7AE
    • putative ribosomal protein
    • ribosomal family protein, L7Ae/L30e/S12e/Gadd45
    • ribosomal protein L7/L12
    • ribosomal protein L7Ae/L30e/S12e/Gadd45
    • ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein
  • strand?: +
  • coordinates?: 3906310..3906627
  • synteny block?: BlockID0026460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1177 (rpl7AE)
    USA300_FPR3757:
    04-02981:
    SA2981_1226
    08BA02176:
    C248_1301
    11819-97:
    MS7_1226
    71193:
    ST398NM01_1270
    ECT-R 2:
    ECTR2_1124
    ED133:
    SAOV_1270
    ED98:
    SAAV_1243
    HO 5096 0412:
    SAEMRSA15_11010
    JH1:
    SaurJH1_1354
    JH9:
    SaurJH9_1328
    JKD6008:
    SAA6008_01223 (rpl7AE)
    JKD6159:
    SAA6159_01123 (rpl7AE)
    LGA251:
    SARLGA251_11790
    M013:
    M013TW_1208
    MRSA252:
    SAR1244
    MSHR1132:
    SAMSHR1132_11110
    MSSA476:
    SAS1202
    Mu3:
    SAHV_1258
    Mu50:
    SAV1268
    MW2:
    MW1151
    RF122:
    SAB1130
    ST398:
    SAPIG1270
    T0131:
    SAT0131_01321
    TCH60:
    HMPREF0772_11961 (rplL2)
    TW20:
    SATW20_12620
    USA300_TCH1516:
    USA300HOU_1200 (rplL2)
    VC40:
    SAVC_05505

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSIDQILNFLGLAMRAGKVKTGESVIVNEIKKGNLKLVIVANDASDNTAKLITDKCKSYK
    N315            MSIDQILNFLGLAMRAGKVKTGESVIVNEIKKGNLKLVIVANDASDNTAKLITDKCKSYK
    NCTC8325        MSIDQILNFLGLAMRAGKVKTGESVIVNEIKKGNLKLVIVANDASDNTAKLITDKCKSYK
    Newman          MSIDQILNFLGLAMRAGKVKTGESVIVNEIKKGNLKLVIVANDASDNTAKLITDKCKSYK
    USA300_FPR3757  MSIDQILNFLGLAMRAGKVKTGESVIVNEIKKGNLKLVIVANDASDNTAKLITDKCKSYK
                    ************************************************************

    COL             VPFRKFGNRNELGIALGKGERVNVGITDPGFAKKLLSMIDEYHKE
    N315            VPFRKFGNRNELGIALGKGERVNVGITDPGFAKKLLSMIDEYHKE
    NCTC8325        VPFRKFGNRNELGIALGKGERVNVGITDPGFAKKLLSMIDEYHKE
    Newman          VPFRKFGNRNELGIALGKGERVNVGITDPGFAKKLLSMIDEYHKE
    USA300_FPR3757  VPFRKFGNRNELGIALGKGERVNVGITDPGFAKKLLSMIDEYHKE
                    *********************************************