From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003570000
  • symbol?: infB
  • description?: translation initiation factor IF-2

      descriptions from strain specific annotations:

    • translation initiation factor IF-2
    • protein translation initiation factor 2 (IF-2)
  • strand?: +
  • coordinates?: 3906608..3908813
  • synteny block?: BlockID0026470
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1288 (infB)
    N315:
    SA1112 (infB)
    NCTC8325:
    Newman:
    NWMN_1178 (infB)
    USA300_FPR3757:
    04-02981:
    SA2981_1227 (infB)
    08BA02176:
    C248_1302 (infB)
    11819-97:
    MS7_1227 (infB)
    71193:
    ST398NM01_1271
    ECT-R 2:
    ECTR2_1125 (infB)
    ED133:
    SAOV_1271
    ED98:
    SAAV_1244 (infB)
    HO 5096 0412:
    SAEMRSA15_11020 (infB)
    JH1:
    SaurJH1_1355 (infB)
    JH9:
    SaurJH9_1329 (infB)
    JKD6008:
    SAA6008_01224 (infB)
    JKD6159:
    SAA6159_01124 (infB)
    LGA251:
    SARLGA251_11800 (infB)
    M013:
    M013TW_1209
    MRSA252:
    SAR1245 (infB)
    MSHR1132:
    SAMSHR1132_11120
    MSSA476:
    SAS1203 (infB)
    Mu3:
    SAHV_1259 (infB)
    Mu50:
    SAV1269 (infB)
    MW2:
    MW1152 (infB)
    RF122:
    SAB1131 (infB)
    ST398:
    SAPIG1271 (infB)
    T0131:
    SAT0131_01322
    TCH60:
    HMPREF0772_11960 (infB)
    TW20:
    SATW20_12630 (infB)
    USA300_TCH1516:
    USA300HOU_1201 (infB)
    VC40:
    SAVC_05510 (infB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKQRIYEYAKELNLKSKEIIDELKSMNIEVSNHMQALEDDQIKALDKKFKKEQKNDNKQ
    N315            MSKQRIYEYAKELNLKSKEIIDELKSMNIEVSNHMQALEDDQIKALDKKFKKEQKNDNKQ
    NCTC8325        MSKQRIYEYAKELNLKSKEIIDELKSMNIEVSNHMQALEDDQIKALDKKFKKEQKNDNKQ
    Newman          MSKQRIYEYAKELNLKSKEIIDELKSMNIEVSNHMQALEDDQIKALDKKFKKEQKNDNKQ
    USA300_FPR3757  MSKQRIYEYAKELNLKSKEIIDELKSMNIEVSNHMQALEDDQIKALDKKFKKEQKNDNKQ
                    ************************************************************

    COL             STQNNHQKSNNQNQNKGQQKDNKKNQQQNNKGNKGNKKNNRNNKKNNKNNKPQNQPAAPK
    N315            STQNNHQKSNNQNQNKGQQKDNKKNQQQNNKGNKGNKKNNRNNKKNNKNNKPQNQPAAPK
    NCTC8325        STQNNHQKSNNQNQNKGQQKDNKKNQQQNNKGNKGNKKNNRNNKKNNKNNKPQNQPAAPK
    Newman          STQNNHQKSNNQNQNKGQQKDNKKNQQQNNKGNKGNKKNNRNNKKNNKNNKPQNQPAAPK
    USA300_FPR3757  STQNNHQKSNNQNQNKGQQKDNKKNQQQNNKGNKGNKKNNRNNKKNNKNNKPQNQPAAPK
                    ************************************************************

    COL             EIPSKVTYQEGITVGEFADKLNVESSEIIKKLFLLGIVANINQSLNQETIELIADDYGVE
    N315            EIPSKVTYQEGITVGEFADKLNVESSEIIKKLFLLGIVANINQSLNQETIELIADDYGVE
    NCTC8325        EIPSKVTYQEGITVGEFADKLNVESSEIIKKLFLLGIVANINQSLNQETIELIADDYGVE
    Newman          EIPSKVTYQEGITVGEFADKLNVESSEIIKKLFLLGIVANINQSLNQETIELIADDYGVE
    USA300_FPR3757  EIPSKVTYQEGITVGEFADKLNVESSEIIKKLFLLGIVANINQSLNQETIELIADDYGVE
                    ************************************************************

    COL             VEEEVVINEEDLSIYFEDEKDDPEAIERPAVVTIMGHVDHGKTTLLDSIRHTKVTAGEAG
    N315            VEEEVVINEEDLSIYFEDEKDDPEAIERPAVVTIMGHVDHGKTTLLDSIRHTKVTAGEAG
    NCTC8325        VEEEVVINEEDLSIYFEDEKDDPEAIERPAVVTIMGHVDHGKTTLLDSIRHTKVTAGEAG
    Newman          VEEEVVINEEDLSIYFEDEKDDPEAIERPAVVTIMGHVDHGKTTLLDSIRHTKVTAGEAG
    USA300_FPR3757  VEEEVVINEEDLSIYFEDEKDDPEAIERPAVVTIMGHVDHGKTTLLDSIRHTKVTAGEAG
                    ************************************************************

    COL             GITQHIGAYQIENDGKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTIEA
    N315            GITQHIGAYQIENDGKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTIEA
    NCTC8325        GITQHIGAYQIENDGKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTIEA
    Newman          GITQHIGAYQIENDGKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTIEA
    USA300_FPR3757  GITQHIGAYQIENDGKKITFLDTPGHAAFTTMRARGAQVTDITILVVAADDGVMPQTIEA
                    ************************************************************

    COL             INHAKEAEVPIIVAVNKIDKPTSNPDRVMQELTEYGLIPEDWGGETIFVPLSALSGDGID
    N315            INHAKEAEVPIIVAVNKIDKPTSNPDRVMQELTEYGLIPEDWGGETIFVPLSALSGDGID
    NCTC8325        INHAKEAEVPIIVAVNKIDKPTSNPDRVMQELTEYGLIPEDWGGETIFVPLSALSGDGID
    Newman          INHAKEAEVPIIVAVNKIDKPTSNPDRVMQELTEYGLIPEDWGGETIFVPLSALSGDGID
    USA300_FPR3757  INHAKEAEVPIIVAVNKIDKPTSNPDRVMQELTEYGLIPEDWGGETIFVPLSALSGDGID
                    ************************************************************

    COL             DLLEMIGLVAEVQELKANPKNRAVGTVIEAELDKSRGPSASLLVQNGTLNVGDAIVVGNT
    N315            DLLEMIGLVAEVQELKANPKNRAVGTVIEAELDKSRGPSASLLVQNGTLNVGDAIVVGNT
    NCTC8325        DLLEMIGLVAEVQELKANPKNRAVGTVIEAELDKSRGPSASLLVQNGTLNVGDAIVVGNT
    Newman          DLLEMIGLVAEVQELKANPKNRAVGTVIEAELDKSRGPSASLLVQNGTLNVGDAIVVGNT
    USA300_FPR3757  DLLEMIGLVAEVQELKANPKNRAVGTVIEAELDKSRGPSASLLVQNGTLNVGDAIVVGNT
                    ************************************************************

    COL             YGRIRAMVNDLGQRIKTAGPSTPVEITGINDVPQAGDRFVVFSDEKQARRIGESRHEASI
    N315            YGRIRAMVNDLGQRIKTAGPSTPVEITGINDVPQAGDRFVVFSDEKQARRIGESRHEASI
    NCTC8325        YGRIRAMVNDLGQRIKTAGPSTPVEITGINDVPQAGDRFVVFSDEKQARRIGESRHEASI
    Newman          YGRIRAMVNDLGQRIKTAGPSTPVEITGINDVPQAGDRFVVFSDEKQARRIGESRHEASI
    USA300_FPR3757  YGRIRAMVNDLGQRIKTAGPSTPVEITGINDVPQAGDRFVVFSDEKQARRIGESRHEASI
                    ************************************************************

    COL             IQQRQESKNVSLDNLFEQMKQGEMKDLNVIIKGDVQGSVEALAASLMKIDVEGVNVRIIH
    N315            VQQRQESKNVSLDNLFEQMKQGEMKDLNVIIKGDVQGSVEALAASLMKIDVEGVNVRIIH
    NCTC8325        IQQRQESKNVSLDNLFEQMKQGEMKDLNVIIKGDVQGSVEALAASLMKIDVEGVNVRIIH
    Newman          IQQRQESKNVSLDNLFEQMKQGEMKDLNVIIKGDVQGSVEALAASLMKIDVEGVNVRIIH
    USA300_FPR3757  IQQRQESKNVSLDNLFEQMKQGEMKDLNVIIKGDVQGSVEALAASLMKIDVEGVNVRIIH
                    :***********************************************************

    COL             TAVGAINESDVTLANASNGIIIGFNVRPDSGAKRAAEAENVDMRLHRVIYNVIEEIESAM
    N315            TAVGAINESDVTLANASNGIIIGFNVRPDSGAKRAAEAENVDMRLHRVIYNVIEEIESAM
    NCTC8325        TAVGAINESDVTLANASNGIIIGFNVRPDSGAKRAAEAENVDMRLHRVIYNVIEEIESAM
    Newman          TAVGAINESDVTLANASNGIIIGFNVRPDSGAKRAAEAENVDMRLHRVIYNVIEEIESAM
    USA300_FPR3757  TAVGAINESDVTLANASNGIIIGFNVRPDSGAKRAAEAENVDMRLHRVIYNVIEEIESAM
                    ************************************************************

    COL             KGLLDPEFEEQVIGQAEVRQTFKVSKVGTIAGCYVTEGKITRNAGVRIIRDGIVQYEGEL
    N315            KGLLDPEFEEQVIGQAEVRQTFKVSKVGTIAGCYVTEGKITRNAGVRIIRDGIVQYEGEL
    NCTC8325        KGLLDPEFEEQVIGQAEVRQTFKVSKVGTIAGCYVTEGKITRNAGVRIIRDGIVQYEGEL
    Newman          KGLLDPEFEEQVIGQAEVRQTFKVSKVGTIAGCYVTEGKITRNAGVRIIRDGIVQYEGEL
    USA300_FPR3757  KGLLDPEFEEQVIGQAEVRQTFKVSKVGTIAGCYVTEGKITRNAGVRIIRDGIVQYEGEL
                    ************************************************************

    COL             DTLKRFKDDAKEVAKGYECGITIENYNDLKEGDVIEAFEMVEIKR
    N315            DTLKRFKDDAKEVAKGYECGITIENYNDLKEGDVIEAFEMVEIKR
    NCTC8325        DTLKRFKDDAKEVAKGYECGITIENYNDLKEGDVIEAFEMVEIKR
    Newman          DTLKRFKDDAKEVAKGYECGITIENYNDLKEGDVIEAFEMVEIKR
    USA300_FPR3757  DTLKRFKDDAKEVAKGYECGITIENYNDLKEGDVIEAFEMVEIKR
                    *********************************************