From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003573000
  • symbol?: ribC
  • description?: riboflavin kinase / FAD synthase ribC

      descriptions from strain specific annotations:

    • riboflavin kinase / FAD synthase ribC
    • bifunctional riboflavin kinase/FMN adenylyltransferase
    • riboflavin biosynthesis protein RibF
    • Riboflavin kinase / FMN adenylyltransferase
    • bifunctional protein including riboflavin kinase and FAD synthase
    • riboflavin biosynthesis diaminohydroxyphosphoribosylaminopyrimidine deaminase
    • putative riboflavin biosynthesis diaminohydroxyphosphoribosylaminopyrimidine deaminase
    • bifunctional riboflavin kinase/FAD synthase RibC
  • strand?: +
  • coordinates?: 3910671..3911642
  • synteny block?: BlockID0026500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1291 (ribF)
    N315:
    SA1115 (ribC)
    NCTC8325:
    Newman:
    NWMN_1181 (ribF)
    USA300_FPR3757:
    04-02981:
    SA2981_1230 (ribC)
    08BA02176:
    C248_1305
    11819-97:
    MS7_1230 (ribF)
    71193:
    ST398NM01_1274
    ECT-R 2:
    ECTR2_1128 (ribF)
    ED133:
    SAOV_1274 (ribC)
    ED98:
    SAAV_1247 (ribF)
    HO 5096 0412:
    SAEMRSA15_11050
    JH1:
    SaurJH1_1358
    JH9:
    SaurJH9_1332
    JKD6008:
    SAA6008_01227 (ribC)
    JKD6159:
    SAA6159_01127 (ribC)
    LGA251:
    SARLGA251_11830
    M013:
    M013TW_1212
    MRSA252:
    SAR1248
    MSHR1132:
    SAMSHR1132_11150
    MSSA476:
    SAS1206
    Mu3:
    SAHV_1262 (ribC)
    Mu50:
    SAV1272 (ribC)
    MW2:
    MW1155 (ribC)
    RF122:
    SAB1134 (ribC)
    ST398:
    SAPIG1274 (ribF)
    T0131:
    SAT0131_01326
    TCH60:
    HMPREF0772_11957 (ribF)
    TW20:
    SATW20_12660
    USA300_TCH1516:
    USA300HOU_1204 (ribC)
    VC40:
    SAVC_05525

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKVIEVTHPIQSKQYITEDVAMAFGFFDGMHKGHDKVFDILNEIAEARSLKKAVMTFDPH
    N315            MKVIEVTHPIQSKQYITEDVAMAFGFFDGMHKGHDKVFDILNEIAEARSLKKAVMTFDPH
    NCTC8325        MKVIEVTHPIQSKQYITEDVAMAFGFFDGMHKGHDKVFDILNEIAEARSLKKAVMTFDPH
    Newman          MKVIEVTHPIQSKQYITEDVAMAFGFFDGMHKGHDKVFDILNEIAEARSLKKAVMTFDPH
    USA300_FPR3757  MKVIEVTHPIQSKQYITEDVAMAFGFFDGMHKGHDKVFDILNEIAEARSLKKAVMTFDPH
                    ************************************************************

    COL             PSVVLNPKRKRTTYLTPLSDKIEKISQHDIDYCIVVNFSSRFANVSVEDFVENYIIKNNV
    N315            PSVVLNPKRKRTTYLTPLSDKIEKISQHDIDYCIVVNFSSRFANVSVEDFVENYIIKNNV
    NCTC8325        PSVVLNPKRKRTTYLTPLSDKIEKISQHDIDYCIVVNFSSRFANVSVEDFVENYIIKNNV
    Newman          PSVVLNPKRKRTTYLTPLSDKIEKISQHDIDYCIVVNFSSRFANVSVEDFVENYIIKNNV
    USA300_FPR3757  PSVVLNPKRKRTTYLTPLSDKIEKISQHDIDYCIVVNFSSRFANVSVEDFVENYIIKNNV
                    ************************************************************

    COL             KEVIAGFDFTFGKFGKGNMTVLQEYDAFNTTIVSKQEIENEKISTTSIRQDLINGELQKA
    N315            KEVIAGFDFTFGKFGKGNMTVLQEYDAFNTTIVSKQEIENEKISTTSIRQDLINGELQKA
    NCTC8325        KEVIAGFDFTFGKFGKGNMTVLQEYDAFNTTIVSKQEIENEKISTTSIRQDLINGELQKA
    Newman          KEVIAGFDFTFGKFGKGNMTVLQEYDAFNTTIVSKQEIENEKISTTSIRQDLINGELQKA
    USA300_FPR3757  KEVIAGFDFTFGKFGKGNMTVLQEYDAFNTTIVSKQEIENEKISTTSIRQDLINGELQKA
                    ************************************************************

    COL             NDALGYIYSIKGTVVQGEKRGRTIGFPTANIQPSDDYLLPRKGVYAVSIEIGTENKLYRG
    N315            NDALGYIYSIKGTVVQGEKRGRTIGFPTANIQPSDDYLLPRKGVYAVSIEIGTENKLYRG
    NCTC8325        NDALGYIYSIKGTVVQGEKRGRTIGFPTANIQPSDDYLLPRKGVYAVSIEIGTENKLYRG
    Newman          NDALGYIYSIKGTVVQGEKRGRTIGFPTANIQPSDDYLLPRKGVYAVSIEIGTENKLYRG
    USA300_FPR3757  NDALGYIYSIKGTVVQGEKRGRTIGFPTANIQPSDDYLLPRKGVYAVSIEIGTENKLYRG
                    ************************************************************

    COL             VANIGVKPTFHDPNKAEVVIEVNIFDFEDNIYGERVTVNWHHFLRPEIKFDGIDPLVKQM
    N315            VANIGVKPTFHDPNKAEVVIEVNIFDFEDNIYGERVTVNWHHFLRPEIKFDGIDPLVKQM
    NCTC8325        VANIGVKPTFHDPNKAEVVIEVNIFDFEDNIYGERVTVNWHHFLRPEIKFDGIDPLVKQM
    Newman          VANIGVKPTFHDPNKAEVVIEVNIFDFEDNIYGERVTVNWHHFLRPEIKFDGIDPLVKQM
    USA300_FPR3757  VANIGVKPTFHDPNKAEVVIEVNIFDFEDNIYGERVTVNWHHFLRPEIKFDGIDPLVKQM
                    ************************************************************

    COL             NDDKSRAKYLLAVDFGDEVAYNI
    N315            NDDKSRAKYLLAVDFGDEVAYNI
    NCTC8325        NDDKSRAKYLLAVDFGDEVAYNI
    Newman          NDDKSRAKYLLAVDFGDEVAYNI
    USA300_FPR3757  NDDKSRAKYLLAVDFGDEVAYNI
                    ***********************