Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003579000
  • symbol?:
  • description?: peptidase M16 domain-containing protein

      descriptions from strain specific annotations:

    • peptidase M16 domain-containing protein
    • Zinc protease
    • peptidase M16 inactive domain protein
    • processing proteinase-like protein, pqqL
    • Peptidase M16 domain protein
    • M16C subfamily peptidase
    • peptidase M16 inactive domain family
    • Non-proteolytic protein, peptidase family M16
  • strand?: +
  • coordinates?: 3919819..3921084
  • synteny block?: BlockID0026560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1236
    08BA02176:
    C248_1311
    11819-97:
    MS7_1236
    71193:
    ST398NM01_1280
    ECT-R 2:
    ECTR2_1134
    ED133:
    SAOV_1280
    ED98:
    SAAV_1253
    HO 5096 0412:
    SAEMRSA15_11110
    JH1:
    SaurJH1_1364
    JH9:
    SaurJH9_1338
    JKD6008:
    SAA6008_01233
    JKD6159:
    SAA6159_01133
    LGA251:
    SARLGA251_11890
    M013:
    M013TW_1218
    MRSA252:
    SAR1254
    MSHR1132:
    SAMSHR1132_11210
    MSSA476:
    SAS1212
    Mu3:
    SAHV_1268
    Mu50:
    SAV1278
    MW2:
    MW1161
    RF122:
    SAB1140
    ST398:
    SAPIG1280
    T0131:
    SAT0131_01334
    TCH60:
    HMPREF0772_11951
    TW20:
    SATW20_12720
    USA300_TCH1516:
    USA300HOU_1210
    VC40:
    SAVC_05555

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSRQSQPNIHIKVSPTTKFKTTTIVFKFMAPLEYDTITARSLLSKLLVRATKKWPTDKSF
    N315            MSRQSQPNIHIKVSPTTKFKTTTIVFKFMAPLEYDTITARSLLSKLLVRATKKWPTDKSF
    NCTC8325        MSRQSQPNIHIKVSPTTKFKTTTIVFKFMAPLEYDTITARSLLSKLLVRATKKWPTDKSF
    Newman          MSRQSQPNIHIKVSPTTKFKTTTIVFKFMAPLEYDTITARSLLSKLLVRATKKWPTDKSF
    USA300_FPR3757  MSRQSQPNIHIKVSPTTKFKTTTIVFKFMAPLEYDTITARSLLSKLLVRATKKWPTDKSF
                    ************************************************************

    COL             NNHLADLYGAYVNSTISKFKDQHVITFSLEIVNERYLRNGESLFNQGLDLLQEIIWNPLI
    N315            NNHLADLYGAYVNSTISKFKDQHVITFSLEIVNERYLRNGESLFNQGLDLLQEIIWNPLI
    NCTC8325        NNHLADLYGAYVNSTISKFKDQHVITFSLEIVNERYLRNGESLFNQGLDLLQEIIWNPLI
    Newman          NNHLADLYGAYVNSTISKFKDQHVITFSLEIVNERYLRNGESLFNQGLDLLQEIIWNPLI
    USA300_FPR3757  NNHLADLYGAYVNSTISKFKDQHVITFSLEIVNERYLRNGESLFNQGLDLLQEIIWNPLI
                    ************************************************************

    COL             ENKAFNDNFVNQEKTLLAKKIEAMVDNKAQYSFLKLLDHMFENEAYKYLSTGQLEQIPHI
    N315            ENKAFNDNFVNQEKTLLAKKIEAMVDNKAQYSFLKLLDHMFENEAYKYLSTGQLEQIPHI
    NCTC8325        ENKAFNDNFVNQEKTLLAKKIEAMVDNKAQYSFLKLLDHMFENEAYKYLSTGQLEQIPHI
    Newman          ENKAFNDNFVNQEKTLLAKKIEAMVDNKAQYSFLKLLDHMFENEAYKYLSTGQLEQIPHI
    USA300_FPR3757  ENKAFNDNFVNQEKTLLAKKIEAMVDNKAQYSFLKLLDHMFENEAYKYLSTGQLEQIPHI
                    ************************************************************

    COL             TAETLYHTYQSMINNDQCSVYVVGNVEPESVEKQIREKFALKPFDKHQFQHSTHHLHDEE
    N315            TAETLYHTYQSMINNDQCSVYVVGNVEPESVEKQIREKFALKPFDKHQFQHSTHHLHDEE
    NCTC8325        TAETLYHTYQSMINNDQCSVYVVGNVEPESVEKQIREKFALKPFDKHQFQHSTHHLHDEE
    Newman          TAETLYHTYQSMINNDQCSVYVVGNVEPESVEKQIREKFALKPFDKHQFQHSTHHLHDEE
    USA300_FPR3757  TAETLYHTYQSMINNDQCSVYVVGNVEPESVEKQIREKFALKPFDKHQFQHSTHHLHDEE
                    ************************************************************

    COL             VDYIVEYDDVDQAKLNMGYRFPTQYGQSGYAAFVVFNMMFGGDPSSVLFNEVREKQSLAY
    N315            VDYIVEYDDVDQAKLNMGYRFPTQYGQSGYAAFVVFNMMFGGDPSSVLFNEVREKQSLAY
    NCTC8325        VDYIVEYDDVDQAKLNMGYRFPTQYGQSGYAAFVVFNMMFGGDPSSVLFNEVREKQSLAY
    Newman          VDYIVEYDDVDQAKLNMGYRFPTQYGQSGYAAFVVFNMMFGGDPSSVLFNEVREKQSLAY
    USA300_FPR3757  VDYIVEYDDVDQAKLNMGYRFPTQYGQSGYAAFVVFNMMFGGDPSSVLFNEVREKQSLAY
                    ************************************************************

    COL             SIHSQIDGKNGYLFVLSGVSSDKYETAKDTIISEFEKIKAGDFTEEKLELAKKVIISHRY
    N315            SIHSQIDGKNGYLFVLSGVSSDKYETAKDTIISEFEKIKAGDFTEEKLELAKKVIISHRY
    NCTC8325        SIHSQIDGKNGYLFVLSGVSSDKYETAKDTIISEFEKIKAGDFTEEKLELAKKVIISHRY
    Newman          SIHSQIDGKNGYLFVLSGVSSDKYETAKDTIISEFEKIKAGDFTEEKLELAKKVIISHRY
    USA300_FPR3757  SIHSQIDGKNGYLFVLSGVSSDKYETAKDTIISEFEKIKAGDFTEEKLELAKKVIISHRY
                    ************************************************************

    COL             ESEDRPKSIIEIMHNQILLEQPQSKETFINDIQKVSREDIVSVAEKAFLDTIYVLTKGGD
    N315            ESEDRPKSIIEIMHNQILLEQPQSKETFINDIQKVSREDIVSVAEKAFLDTIYVLTKGGD
    NCTC8325        ESEDRPKSIIEIMHNQILLEQPQSKETFINDIQKVSREDIVSVAEKAFLDTIYVLTKGGD
    Newman          ESEDRPKSIIEIMHNQILLEQPQSKETFINDIQKVSREDIVSVAEKAFLDTIYVLTKGGD
    USA300_FPR3757  ESEDRPKSIIEIMHNQILLEQPQSKETFINDIQKVSREDIVSVAEKAFLDTIYVLTKGGD
                    ************************************************************

    COL             K
    N315            K
    NCTC8325        K
    Newman          K
    USA300_FPR3757  K
                    *