From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003584000
  • symbol?:
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • transcriptional regulator Cro/CI family protein
    • Cro/CI family transcriptional regulator
    • DNA-binding protein
    • Helix-turn-helix domain protein
    • putative DNA-binding protein
    • transcriptional regulator, putative
  • strand?: +
  • coordinates?: 3924036..3924428
  • synteny block?: BlockID0026610
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1240
    08BA02176:
    C248_1315
    11819-97:
    MS7_1240
    71193:
    ST398NM01_1284
    ECT-R 2:
    ECTR2_1138
    ED133:
    SAOV_1284
    ED98:
    SAAV_1257
    HO 5096 0412:
    SAEMRSA15_11150
    JH1:
    SaurJH1_1368
    JH9:
    SaurJH9_1342
    JKD6008:
    SAA6008_01237
    JKD6159:
    SAA6159_01137
    LGA251:
    SARLGA251_11930
    M013:
    M013TW_1224
    MRSA252:
    SAR1258
    MSHR1132:
    SAMSHR1132_11250
    MSSA476:
    SAS1216
    Mu3:
    SAHV_1272
    Mu50:
    SAV1282
    MW2:
    MW1165
    RF122:
    SAB1144
    ST398:
    SAPIG1284
    T0131:
    SAT0131_01338 (galM)
    TCH60:
    HMPREF0772_11946
    TW20:
    SATW20_12760
    USA300_TCH1516:
    USA300HOU_1214
    VC40:
    SAVC_05575

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKTVGEALKGRRERLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASV
    N315            MKTVGEALKGRRERLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASV
    NCTC8325        MKTVGEALKGRRERLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASV
    Newman          MKTVGEALKGRRERLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASV
    USA300_FPR3757  MKTVGEALKGRRERLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASV
                    ************************************************************

    COL             VNIEPNQLIQAHQDEIPSNQAEWDEVITVFNNNKDLDYKSKSKEPIQLLVIMGITVLITL
    N315            VNIEPNQLIQAHQDEIPSNQAEWDEVITVFNNNKDLDYKSKSKEPIQLLVIMGITVLITL
    NCTC8325        VNIEPNQLIQAHQDEIPSNQAEWDEVITVFNNNKDLDYKSKSKEPIQLLVIMGITVLITL
    Newman          VNIEPNQLIQAHQDEIPSNQAEWDEVITVFNNNKDLDYKSKSKEPIQLLVIMGITVLITL
    USA300_FPR3757  VNIEPNQLIQAHQDEIPSNQAEWDEVITVFNNNKDLDYKSKSKEPIQLLVIMGITVLITL
                    ************************************************************

    COL             LLWIMLVLIF
    N315            LLWIMLVLIF
    NCTC8325        LLWIMLVLIF
    Newman          LLWIMLVLIF
    USA300_FPR3757  LLWIMLVLIF
                    **********