From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003586000
  • symbol?: cinA
  • description?: competence-damage inducible protein cinA

      descriptions from strain specific annotations:

    • competence-damage inducible protein cinA
    • competence/damage-inducible protein CinA
    • putative competence-damage inducible protein
    • molybdenum cofactor synthesis domain-containing protein
    • competence/damage-inducible protein CinA N-domain, putative
    • Colligrin
  • strand?: +
  • coordinates?: 3925990..3927204
  • synteny block?: BlockID0026630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1127 (cinA)
    NCTC8325:
    Newman:
    NWMN_1193 (cinA)
    USA300_FPR3757:
    04-02981:
    SA2981_1242 (cinA)
    08BA02176:
    C248_1317
    11819-97:
    MS7_1242
    71193:
    ST398NM01_1286
    ECT-R 2:
    ECTR2_1140
    ED133:
    SAOV_1286 (cinA)
    ED98:
    SAAV_1259
    HO 5096 0412:
    SAEMRSA15_11170
    JH1:
    SaurJH1_1370
    JH9:
    SaurJH9_1344
    JKD6008:
    SAA6008_01239 (cinA)
    JKD6159:
    SAA6159_01139 (cinA)
    LGA251:
    SARLGA251_11950
    M013:
    M013TW_1226
    MRSA252:
    SAR1260
    MSHR1132:
    SAMSHR1132_11270
    MSSA476:
    SAS1218
    Mu3:
    SAHV_1274 (cinA)
    Mu50:
    SAV1284 (cinA)
    MW2:
    MW1167 (cinA)
    RF122:
    SAB1146 (cinA)
    ST398:
    SAPIG1286
    T0131:
    SAT0131_01340
    TCH60:
    HMPREF0772_11944 (cinA)
    TW20:
    SATW20_12780
    USA300_TCH1516:
    USA300HOU_1216 (cinA)
    VC40:
    SAVC_05585

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSIAIIAVGSELLLGQIANTNGQFLSKVFNEIGQNVLEHKVIGDNKKRLESSVRHALEKY
    N315            MSIAIIAVGSELLLGQIANTNGQFLSKVFNEIGQNVLEHKVIGDNKKRLESSVRHALEKY
    NCTC8325        MSIAIIAVGSELLLGQIANTNGQFLSKVFNEIGQNVLEHKVIGDNKKRLESSVRHALEKY
    Newman          MSIAIIAVGSELLLGQIANTNGQFLSKVFNEIGQNVLEHKVIGDNKKRLESSVRHALEKY
    USA300_FPR3757  MSIAIIAVGSELLLGQIANTNGQFLSKVFNEIGQNVLEHKVIGDNKKRLESSVRHALEKY
                    ************************************************************

    COL             DTVILTGGLGPTKDDLTKHTVAQIVGKDLVIDEPSLKYIESYFEEQGQEMTPNNKQQALV
    N315            DTVILTGGLGPTKDDLTKHTVAQIVGKDLVIDEPSLKYIESYFEEQGQEMTPNNKQQALV
    NCTC8325        DTVILTGGLGPTKDDLTKHTVAQIVGKDLVIDEPSLKYIESYFEEQGQEMTPNNKQQALV
    Newman          DTVILTGGLGPTKDDLTKHTVAQIVGKDLVIDEPSLKYIESYFEEQGQEMTPNNKQQALV
    USA300_FPR3757  DTVILTGGLGPTKDDLTKHTVAQIVGKDLVIDEPSLKYIESYFEEQGQEMTPNNKQQALV
                    ************************************************************

    COL             IEGSTVLTNHHGMAPGMMVNFENKQIILLPGPPKEMQPMVKNELLSHFINHNRIIHSELL
    N315            IEGSTVLANHHGMAPGMMVNFENKQIILLPGPPKEMQPMVKNELLSHFINHNRIIHSELL
    NCTC8325        IEGSTVLTNHHGMAPGMMVNFENKQIILLPGPPKEMQPMVKNELLSHFINHNRIIHSELL
    Newman          IEGSTVLTNHHGMAPGMMVNFENKQIILLPGPPKEMQPMVKNELLSHFINHNRIIHSELL
    USA300_FPR3757  IEGSTVLTNHHGMAPGMMVNFENKQIILLPGPPKEMQPMVKNELLSHFINHNRIIHSELL
                    *******:****************************************************

    COL             RFAGIGESKVETILIDLIDKQTNPTIAPLAGSHEVYIRLTANADSKEQAQSLIQPVKQEI
    N315            RFAGIGESKVETILIDLIDKQTNPTIAPLAGSHEVYIRLTANADSKEQAQSLIQPVKQEI
    NCTC8325        RFAGIGESKVETILIDLIDKQTNPTIAPLAGSHEVYIRLTANADSKEQAQSLIQPVKQEI
    Newman          RFAGIGESKVETILIDLIDKQTNPTIAPLAGSHEVYIRLTANADSKEQAQSLIQPVKQEI
    USA300_FPR3757  RFAGIGESKVETILIDLIDKQTNPTIAPLAGSHEVYIRLTANADSKEQAQSLIQPVKQEI
                    ************************************************************

    COL             LDRIGEYYYGSDDTLIEQAVIKKIHEPFVIYDGITNGALYHRLKEVDLNDVLKGMINHNE
    N315            LDRIGEYYYGSDDTLIEQAVIKKIHEPFVIYDGITNGALYHRLKEVDLNDVLKGMINHNE
    NCTC8325        LDRIGEYYYGSDDTLIEQAVIKKIHEPFVIYDGITNGALYHRLKEVDLNDVLKGMINHNE
    Newman          LDRIGEYYYGSDDTLIEQAVIKKIHEPFVIYDGITNGALYHRLKEVDLNDVLKGMINHNE
    USA300_FPR3757  LDRIGEYYYGSDDTLIEQAVIKKIHEPFVIYDGITNGALYHRLKEVDLNDVLKGMINHNE
                    ************************************************************

    COL             NFVDINKPIEQQLKDAVQFVNKLFNVSSAIILLEYDGVVHIGYDNNFEFKTEQFKMSKSR
    N315            NFVDINKPIEQQLKDAVQFVNKLFNVSSAIILLEYDGVVHIGYDNNFEFKTEQFKMSKSR
    NCTC8325        NFVDINKPIEQQLKDAVQFVNKLFNVSSAIILLEYDGVVHIGYDNNFEFKTEQFKMSKSR
    Newman          NFVDINKPIEQQLKDAVQFVNKLFNVSSAIILLEYDGVVHIGYDNNFEFKTEQFKMSKSR
    USA300_FPR3757  NFVDINKPIEQQLKDAVQFVNKLFNVSSAIILLEYDGVVHIGYDNNFEFKTEQFKMSKSR
                    ************************************************************

    COL             NLLKNRSQNYALIRLLNWLRTTN
    N315            NLLKNRSQNYVLIRLLNWLRTTN
    NCTC8325        NLLKNRSQNYALIRLLNWLRTTN
    Newman          NLLKNRSQNYALIRLLNWLRTTN
    USA300_FPR3757  NLLKNRSQNYALIRLLNWLRTTN
                    **********.************