From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003590000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 3932572..3932742
  • synteny block?: BlockID0026670
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1245
    08BA02176:
    C248_1320
    11819-97:
    MS7_1245
    71193:
    ST398NM01_1289
    ECT-R 2:
    ECTR2_1143
    ED133:
    SAOV_1289c
    ED98:
    SAAV_1262
    HO 5096 0412:
    SAEMRSA15_11220
    JH1:
    SaurJH1_1373
    JH9:
    SaurJH9_1347
    JKD6008:
    SAA6008_01242
    JKD6159:
    SAA6159_01142
    LGA251:
    SARLGA251_11980
    M013:
    M013TW_1229
    MRSA252:
    SAR1263
    MSHR1132:
    SAMSHR1132_11300
    MSSA476:
    SAS1221
    Mu3:
    SAHV_1277
    Mu50:
    SAV1287
    MW2:
    MW1170
    RF122:
    SAB1149c
    ST398:
    SAPIG1289
    T0131:
    SAT0131_01343
    TCH60:
    HMPREF0772_11941
    TW20:
    SATW20_12810
    USA300_TCH1516:
    USA300HOU_1219
    VC40:
    SAVC_05600

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSINIDPEKFAELVVMSNPSKFEDAEDIAKESLKLYINAYRLAERYSTIATNCYDTAEVI
    N315            ---------------MSNPSKFEDAEDIAKESLKLYINAYRLAERYSTIATNCYDTAEVI
    NCTC8325        MSINIDPEKFAELVVMSNPSKFEDAEDIAKESLKLYINAYRLAERYSTIATNCYDTAEVI
    Newman          MSINIDPEKFAELVVMSNPSKFEDAEDIAKESLKLYINAYRLAERYSTIATNCYDTAEVI
    USA300_FPR3757  MSINIDPEKFAELVVMSNPSKFEDAEDIAKESLKLYINAYRLAERYSTIATNCYDTAEVI
                                   *********************************************

    COL             KELKKTDLQLK
    N315            KELKKTDLQLK
    NCTC8325        KELKKTDLQLK
    Newman          KELKKTDLQLK
    USA300_FPR3757  KELKKTDLQLK
                    ***********