From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003591000
  • symbol?:
  • description?: Phosphoesterase family protein

      descriptions from strain specific annotations:

    • Phosphoesterase family protein
    • calcineurin-like phosphoesterase family protein
    • putative phosphoesterase
    • ABC superfamily ATP binding cassette transporter, binding protein
    • Metallophosphoesterase
    • Ser/Thr protein phosphatase
    • putative metallophosphoesterase
  • strand?: +
  • coordinates?: 3932961..3933752
  • synteny block?: BlockID0026680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1246
    08BA02176:
    C248_1321
    11819-97:
    MS7_1246
    71193:
    ST398NM01_1290
    ECT-R 2:
    ECTR2_1144
    ED133:
    SAOV_1290
    ED98:
    SAAV_1263
    HO 5096 0412:
    SAEMRSA15_11230
    JH1:
    SaurJH1_1374
    JH9:
    SaurJH9_1348
    JKD6008:
    SAA6008_01243
    JKD6159:
    SAA6159_01143
    LGA251:
    SARLGA251_11990
    M013:
    M013TW_1230
    MRSA252:
    SAR1264
    MSHR1132:
    SAMSHR1132_11310
    MSSA476:
    SAS1222
    Mu3:
    SAHV_1278
    Mu50:
    SAV1288
    MW2:
    MW1171
    RF122:
    SAB1150
    ST398:
    SAPIG1290
    T0131:
    SAT0131_01344
    TCH60:
    HMPREF0772_11940
    TW20:
    SATW20_12820
    USA300_TCH1516:
    USA300HOU_1220
    VC40:
    SAVC_05605

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRIMFIGDIVGKIGRDAIETYIPQLKQKYKPTVTIVNAENAAHGKGLTEKIYKQLLRNGV
    N315            MRIMFIGDIVGKIGRDAIETYIPQLKQKYKPTVTIVNAENAAHGKGLTEKIYKQLLRNGV
    NCTC8325        MRIMFIGDIVGKIGRDAIETYIPQLKQKYKPTVTIVNAENAAHGKGLTEKIYKQLLRNGV
    Newman          MRIMFIGDIVGKIGRDAIETYIPQLKQKYKPTVTIVNAENAAHGKGLTEKIYKQLLRNGV
    USA300_FPR3757  MRIMFIGDIVGKIGRDAIETYIPQLKQKYKPTVTIVNAENAAHGKGLTEKIYKQLLRNGV
                    ************************************************************

    COL             DFMTMGNHTYGQREIYDFIDEAKRLVRPANFPDEAPGIGMRFIQINDIKLAVINLQGRAF
    N315            DFMTMGNHTYGQREIYDFIDEAKRLVRPANFPDEAPGIGMRFIQINDIKLAVINLQGRAF
    NCTC8325        DFMTMGNHTYGQREIYDFIDEAKRLVRPANFPDEAPGIGMRFIQINDIKLAVINLQGRAF
    Newman          DFMTMGNHTYGQREIYDFIDEAKRLVRPANFPDEAPGIGMRFIQINDIKLAVINLQGRAF
    USA300_FPR3757  DFMTMGNHTYGQREIYDFIDEAKRLVRPANFPDEAPGIGMRFIQINDIKLAVINLQGRAF
                    ************************************************************

    COL             MPDIDDPFKKADQLVKEAQEQTPFIFVDFHAETTSEKYAMGWHLDGRASAVVGTHTHIQT
    N315            MPDIDDPFKKADQLVKEAQEQTPFIFVDFHAETTSEKYAMGWHLDGRASAVVGTHTHIQT
    NCTC8325        MPDIDDPFKKADQLVKEAQEQTPFIFVDFHAETTSEKYAMGWHLDGRASAVVGTHTHIQT
    Newman          MPDIDDPFKKADQLVKEAQEQTPFIFVDFHAETTSEKYAMGWHLDGRASAVVGTHTHIQT
    USA300_FPR3757  MPDIDDPFKKADQLVKEAQEQTPFIFVDFHAETTSEKYAMGWHLDGRASAVVGTHTHIQT
                    ************************************************************

    COL             ADERILPKGTGYITDVGMTGFYDGILGINKTEVIERFITSLPQRHVVPNEGRSVLSGVVI
    N315            ADERILPKGTGYITDVGMTGFYDGILGINKTEVIERFITSLPQRHVVPNEGRSVLSGVVI
    NCTC8325        ADERILPKGTGYITDVGMTGFYDGILGINKTEVIERFITSLPQRHVVPNEGRSVLSGVVI
    Newman          ADERILPKGTGYITDVGMTGFYDGILGINKTEVIERFITSLPQRHVVPNEGRSVLSGVVI
    USA300_FPR3757  ADERILPKGTGYITDVGMTGFYDGILGINKTEVIERFITSLPQRHVVPNEGRSVLSGVVI
                    ************************************************************

    COL             DLDKEGKTKHIERILINDDHPFSTF
    N315            DLDKEGKTKHIERILINDDHPFSTF
    NCTC8325        DLDKEGKTKHIERILINDDHPFSTF
    Newman          DLDKEGKTKHIERILINDDHPFSTF
    USA300_FPR3757  DLDKEGKTKHIERILINDDHPFSTF
                    *************************