From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003595000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3937670..3938003
  • synteny block?: BlockID0026720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1249
    08BA02176:
    C248_1325
    11819-97:
    MS7_1249
    71193:
    ST398NM01_1294
    ECT-R 2:
    ECTR2_1147
    ED133:
    SAOV_1293
    ED98:
    SAAV_1266
    HO 5096 0412:
    SAEMRSA15_11260
    JH1:
    SaurJH1_1377
    JH9:
    SaurJH9_1351
    JKD6008:
    SAA6008_01246
    JKD6159:
    SAA6159_01146
    LGA251:
    SARLGA251_12020
    M013:
    M013TW_1233
    MRSA252:
    SAR1267
    MSHR1132:
    SAMSHR1132_11340
    MSSA476:
    SAS1225
    Mu3:
    SAHV_1281
    Mu50:
    SAV1291
    MW2:
    MW1174
    RF122:
    SAB1153
    ST398:
    SAPIG1294
    T0131:
    SAT0131_01347
    TCH60:
    HMPREF0772_11937
    TW20:
    SATW20_12850
    USA300_TCH1516:
    USA300HOU_1223
    VC40:
    SAVC_05620

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKDTLMSIQIIPKTPNNDNVIPYVDEAIKIIDESGLHFRVGPLETTVQGNMNECLILIQS
    N315            MKDTLMSIQIIPKTPNNDNVIPYVDEAIKIIDESGLHFRVGPLETTVQGNMNECLILIQS
    NCTC8325        MKDTLMSIQIIPKTPNNDNVIPYVDEAIKIIDESGLHFRVGPLETTVQGNMNECLILIQS
    Newman          MKDTLMSIQIIPKTPNNDNVIPYVDEAIKIIDESGLHFRVGPLETTVQGNMNECLILIQS
    USA300_FPR3757  MKDTLMSIQIIPKTPNNDNVIPYVDEAIKIIDESGLHFRVGPLETTVQGNMNECLILIQS
                    ************************************************************

    COL             LNERMVELECPSIISQVKFYHVPDGITIETLTEKYDE
    N315            LNERMVELECPSIISQVKFYHVPDGITIETLTEKYDE
    NCTC8325        LNERMVELECPSIISQVKFYHVPDGITIETLTEKYDE
    Newman          LNERMVELECPSIISQVKFYHVPDGITIETLTEKYDE
    USA300_FPR3757  LNERMVELECPSIISQVKFYHVPDGITIETLTEKYDE
                    *************************************