From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003596000
  • symbol?: miaB
  • description?: (dimethylallyl)adenosine tRNA methylthiotransferase

      descriptions from strain specific annotations:

    • (dimethylallyl)adenosine tRNA methylthiotransferase
    • tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB
    • tRNA-i(6)A37 thiotransferase enzyme MiaB
    • (dimethylallyl)adenosine tRNA methylthiotransferase MiaB
    • radical SAM superfamily protein
    • tRNA 2-methylthioadenosine synthase
    • tRNA-i(6)A37 methylthiotransferase
    • tRNA-i(6)A37 modification enzyme MiaB
  • strand?: +
  • coordinates?: 3938142..3939686
  • synteny block?: BlockID0026730
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1312 (miaB)
    N315:
    NCTC8325:
    Newman:
    NWMN_1201 (miaB)
    USA300_FPR3757:
    04-02981:
    SA2981_1250
    08BA02176:
    C248_1326
    11819-97:
    MS7_1250 (miaB)
    71193:
    ST398NM01_1295
    ECT-R 2:
    ECTR2_1148 (miaB)
    ED133:
    SAOV_1294
    ED98:
    SAAV_1267 (miaB)
    HO 5096 0412:
    SAEMRSA15_11270
    JH1:
    SaurJH1_1378
    JH9:
    SaurJH9_1352
    JKD6008:
    SAA6008_01247 (miaB)
    JKD6159:
    SAA6159_01147 (miaB)
    LGA251:
    SARLGA251_12030
    M013:
    M013TW_1234
    MRSA252:
    SAR1268
    MSHR1132:
    SAMSHR1132_11350
    MSSA476:
    SAS1226
    Mu3:
    SAHV_1282
    Mu50:
    SAV1292
    MW2:
    MW1175
    RF122:
    SAB1154
    ST398:
    SAPIG1295 (miaB)
    T0131:
    SAT0131_01348
    TCH60:
    HMPREF0772_11936 (miaB2)
    TW20:
    SATW20_12860
    USA300_TCH1516:
    USA300HOU_1224 (miaB)
    VC40:
    SAVC_05625

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNEEQRKASSVDVLAERDKKAEKDYSKYFEHVYQPPNLKEAKKRGKQEVRYNRDFQIDEK
    N315            MNEEQRKASSVDVLAERDKKAEKDYSKYFEHVYQPPNLKEAKKRGKQEVRYNRDFQIDEK
    NCTC8325        MNEEQRKASSVDVLAERDKKAEKDYSKYFEHVYQPPNLKEAKKRGKQEVRYNRDFQIDEK
    Newman          MNEEQRKASSVDVLAERDKKAEKDYSKYFEHVYQPPNLKEAKKRGKQEVRYNRDFQIDEK
    USA300_FPR3757  MNEEQRKASSVDVLAERDKKAEKDYSKYFEHVYQPPNLKEAKKRGKQEVRYNRDFQIDEK
                    ************************************************************

    COL             YRGMGNERTFLIKTYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAE
    N315            YRGMGNERTFLIKTYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAE
    NCTC8325        YRGMGNERTFLIKTYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAE
    Newman          YRGMGNERTFLIKTYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAE
    USA300_FPR3757  YRGMGNERTFLIKTYGCQMNAHDTEVIAGILEALGYQATTDINTADVILINTCAIRENAE
                    ************************************************************

    COL             NKVFSEIGNLKHLKKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEI
    N315            NKVFSEIGNLKHLKKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEI
    NCTC8325        NKVFSEIGNLKHLKKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEI
    Newman          NKVFSEIGNLKHLKKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEI
    USA300_FPR3757  NKVFSEIGNLKHLKKERPDILIGVCGCMSQEESVVNKILKSYQNVDMIFGTHNIHHLPEI
                    ************************************************************

    COL             LEEAYLSKAMVVEVWSKEGDVIENLPKVREGNIKAWVNIMYGCDKFCTYCIVPFTRGKER
    N315            LEEAYLSKAMVVEVWSKEGDVIENLPKVREGNIKAWVNIMYGCDKFCTYCIVPFTRGKER
    NCTC8325        LEEAYLSKAMVVEVWSKEGDVIENLPKVREGNIKAWVNIMYGCDKFCTYCIVPFTRGKER
    Newman          LEEAYLSKAMVVEVWSKEGDVIENLPKVREGNIKAWVNIMYGCDKFCTYCIVPFTRGKER
    USA300_FPR3757  LEEAYLSKAMVVEVWSKEGDVIENLPKVREGNIKAWVNIMYGCDKFCTYCIVPFTRGKER
                    ************************************************************

    COL             SRRPEDIIDEVRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKIAIPRVRF
    N315            SRRPEDIIDEVRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKIAIPRVRF
    NCTC8325        SRRPEDIIDEVRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKIAIPRVRF
    Newman          SRRPEDIIDEVRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKIAIPRVRF
    USA300_FPR3757  SRRPEDIIDEVRELAREGYKEITLLGQNVNSYGKDLQDIEYDLGDLLQAISKIAIPRVRF
                    ************************************************************

    COL             TTSHPWDFTDHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDR
    N315            TTSHPWDFTDHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDR
    NCTC8325        TTSHPWDFTDHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDR
    Newman          TTSHPWDFTDHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDR
    USA300_FPR3757  TTSHPWDFTDHMIDVISEGGNIVPHIHLPVQSGNNAVLKIMGRKYTRESYLDLVKRIKDR
                    ************************************************************

    COL             IPNVALTTDIIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLN
    N315            IPNVALTTDIIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLN
    NCTC8325        IPNVALTTDIIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLN
    Newman          IPNVALTTDIIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLN
    USA300_FPR3757  IPNVALTTDIIVGYPNESEEQFEETLTLYDEVGFEHAYTYLYSQRDGTPAAKMKDNVPLN
                    ************************************************************

    COL             VKKERLQRLNKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPK
    N315            VKKERLQRLNKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPK
    NCTC8325        VKKERLQRLNKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPK
    Newman          VKKERLQRLNKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPK
    USA300_FPR3757  VKKERLQRLNKKVGHYSQIAMSKYEGQTVTVLCEGSSKKDDQVLAGYTDKNKLVNFKAPK
                    ************************************************************

    COL             EMIGKLVEVRIDEAKQYSLNGSFIKEVEPEMVIQ
    N315            EMIGKLVEVRIDEAKQYSLNGSFVKEVEPEMVIQ
    NCTC8325        EMIGKLVEVRIDEAKQYSLNGSFIKEVEPEMVIQ
    Newman          EMIGKLVEVRIDEAKQYSLNGSFIKEVEPEMVIQ
    USA300_FPR3757  EMIGKLVEVRIDEAKQYSLNGSFIKEVEPEMVIQ
                    ***********************:**********