From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003609000
  • symbol?: glpP
  • description?: glycerol uptake operon antiterminator regulatory protein

      descriptions from strain specific annotations:

    • glycerol uptake operon antiterminator regulatory protein
    • putative glycerol uptake operon antiterminator regulatory protein
    • glycerol-3-phosphate responsive antiterminator family protein
    • putative glycerol uptake operon antiterminator regulatory protein, GlpP
    • Glycerol-3-phosphate responsive antiterminator
  • strand?: +
  • coordinates?: 3950429..3950971
  • synteny block?: BlockID0026800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1317 (glpP)
    N315:
    SA1139 (glpP)
    NCTC8325:
    Newman:
    NWMN_1206 (glpP)
    USA300_FPR3757:
    04-02981:
    SA2981_1255 (glpP)
    08BA02176:
    C248_1331 (glpP)
    11819-97:
    MS7_1255
    71193:
    ST398NM01_1300
    ECT-R 2:
    ECTR2_1154
    ED133:
    SAOV_1299 (glpP)
    ED98:
    SAAV_1272 (glpP)
    HO 5096 0412:
    SAEMRSA15_11320 (glpP)
    JH1:
    SaurJH1_1383
    JH9:
    SaurJH9_1357
    JKD6008:
    SAA6008_01252 (glpP)
    JKD6159:
    SAA6159_01152 (glpP)
    LGA251:
    SARLGA251_12080 (glpP)
    M013:
    M013TW_1239
    MRSA252:
    SAR1273 (glpP)
    MSHR1132:
    SAMSHR1132_11400
    MSSA476:
    SAS1231
    Mu3:
    SAHV_1287 (glpP)
    Mu50:
    SAV1298 (glpP)
    MW2:
    MW1180 (glpP)
    RF122:
    SAB1159 (glpP)
    ST398:
    SAPIG1300
    T0131:
    SAT0131_01353
    TCH60:
    HMPREF0772_11930 (glpP)
    TW20:
    SATW20_12910 (glpP)
    USA300_TCH1516:
    USA300HOU_1229 (glpP)
    VC40:
    SAVC_05685

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNQVNNNILPAIRNIKDLEKLIKTDYKMCVLLDMHIGHIKSIMELLKQNHIECFIHIDLI
    N315            ---MNNNILPAIRNIKDLEKLIKTDYKMCVLLDMHIGHIKSIMELLKQNHIECFIHIDLI
    NCTC8325        MNQVNNNILPAIRNIKDLEKLIKTDYKMCVLLDMHIGHIKSIMELLKQNHIECFIHIDLI
    Newman          MNQVNNNILPAIRNIKDLEKLIKTDYKMCVLLDMHIGHIKSIMELLKQNHIECFIHIDLI
    USA300_FPR3757  MNQVNNNILPAIRNIKDLEKLIKTDYKMCVLLDMHIGHIKSIMELLKQNHIECFIHIDLI
                       :********************************************************

    COL             KGLSHDEFASEFIIQQYKPKGIVSTKSKVIKKAKSLNTLTIFRVFIIDSQALKRSIDLIK
    N315            KGLSHDEFASEFIIQQYKPKGIVSTKSKVIKKAKSLNTLTIFRVFIIDSQALKRSIDLIK
    NCTC8325        KGLSHDEFASEFIIQQYKPKGIVSTKSKVIKKAKSLNTLTIFRVFIIDSQALKRSIDLIK
    Newman          KGLSHDEFASEFIIQQYKPKGIVSTKSKVIKKAKSLNTLTIFRVFIIDSQALKRSIDLIK
    USA300_FPR3757  KGLSHDEFASEFIIQQYKPKGIVSTKSKVIKKAKSLNTLTIFRVFIIDSQALKRSIDLIK
                    ************************************************************

    COL             KVEPDFVEVLPGVASKAIHHIQKETNTQVIAGGLINTIDEVNEAVKNGAKYVTTSYDKLW
    N315            KVEPDFVEVLPGVASKAIHHIQKETNTQVIAGGLINTIDEVNEAVKNGAKYVTTSYDKLW
    NCTC8325        KVEPDFVEVLPGVASKAIHHIQKETNTQVIAGGLINTIDEVNEAVKNGAKYVTTSYDKLW
    Newman          KVEPDFVEVLPGVASKAIHHIQKETNTQVIAGGLINTIDEVNEAVKNGAKYVTTSYDKLW
    USA300_FPR3757  KVEPDFVEVLPGVASKAIHHIQKETNTQVIAGGLINTIDEVNEAVKNGAKYVTTSYDKLW
                    ************************************************************