From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003611000
  • symbol?: glpF
  • description?: glycerol uptake facilitator

      descriptions from strain specific annotations:

    • glycerol uptake facilitator
    • glycerol uptake facilitator protein
    • MIP family channel protein
    • MIP family major intrinsic protein channel protein
    • putative glycerol uptake facilitator protein
    • MIP channel s family protein
    • MIP family glycerol uptake facilitator protein GlpF
  • strand?: +
  • coordinates?: 3951526..3952344
  • synteny block?: BlockID0026820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1319 (glpF)
    N315:
    SA1140 (glpF)
    NCTC8325:
    Newman:
    NWMN_1207 (glpF)
    USA300_FPR3757:
    04-02981:
    SA2981_1256 (glpF)
    08BA02176:
    C248_1333 (glpF)
    11819-97:
    MS7_1256
    71193:
    ST398NM01_1301
    ECT-R 2:
    ECTR2_1156
    ED133:
    SAOV_1300 (glpF)
    ED98:
    SAAV_1273 (glpF)
    HO 5096 0412:
    SAEMRSA15_11330 (glpF)
    JH1:
    SaurJH1_1384
    JH9:
    SaurJH9_1358
    JKD6008:
    SAA6008_01253 (glpF)
    JKD6159:
    SAA6159_01153 (glpF)
    LGA251:
    SARLGA251_12090 (glpF)
    M013:
    M013TW_1240
    MRSA252:
    SAR1274 (glpF)
    MSHR1132:
    SAMSHR1132_11410
    MSSA476:
    SAS1232
    Mu3:
    SAHV_1289 (glpF)
    Mu50:
    SAV1300 (glpF)
    MW2:
    MW1182 (glpF)
    RF122:
    SAB1160 (glpF)
    ST398:
    SAPIG1301
    T0131:
    SAT0131_01354
    TCH60:
    HMPREF0772_11928 (glpF)
    TW20:
    SATW20_12920 (glpF)
    USA300_TCH1516:
    USA300HOU_1230 (glpF)
    VC40:
    SAVC_05690

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNVYLAEFLGTAILILFGGGVCANVNLKRSAANGADWIVITAGWGLAVTMGVFAVGQFSG
    N315            MNVYLAEFLGTAILILFGGGVCANVNLKRSAANGADWIVITAGWGLAVTMGVFAVGQFSG
    NCTC8325        MNVYLAEFLGTAILILFGGGVCANVNLKRSAANGADWIVITAGWGLAVTMGVFAVGQFSG
    Newman          MNVYLAEFLGTAILILFGGGVCANVNLKRSAANGADWIVITAGWGLAVTMGVFAVGQFSG
    USA300_FPR3757  MNVYLAEFLGTAILILFGGGVCANVNLKRSAANGADWIVITAGWGLAVTMGVFAVGQFSG
                    ************************************************************

    COL             AHLNPAVSLALALDGSFDWSLVPGYIVAQMLGAIVGATIVWLMYLPHWKATEEAGAKLGV
    N315            AHLNPAVSLALALDGSFDWSLVPGYIVAQMLGAIVGATIVWLMYLPHWKATEEAGAKLGV
    NCTC8325        AHLNPAVSLALALDGSFDWSLVPGYIVAQMLGAIVGATIVWLMYLPHWKATEEAGAKLGV
    Newman          AHLNPAVSLALALDGSFDWSLVPGYIVAQMLGAIVGATIVWLMYLPHWKATEEAGAKLGV
    USA300_FPR3757  AHLNPAVSLALALDGSFDWSLVPGYIVAQMLGAIVGATIVWLMYLPHWKATEEAGAKLGV
                    ************************************************************

    COL             FSTAPAIKNYFANFLSEIIGTMALTLGILFIGVNKIADGLNPLIVGALIVAIGLSLGGAT
    N315            FSTAPAIKNYFANFLSEIIGTMALTLGILFIGVNKIADGLNPLIVGALIVAIGLSLGGAT
    NCTC8325        FSTAPAIKNYFANFLSEIIGTMALTLGILFIGVNKIADGLNPLIVGALIVAIGLSLGGAT
    Newman          FSTAPAIKNYFANFLSEIIGTMALTLGILFIGVNKIADGLNPLIVGALIVAIGLSLGGAT
    USA300_FPR3757  FSTAPAIKNYFANFLSEIIGTMALTLGILFIGVNKIADGLNPLIVGALIVAIGLSLGGAT
                    ************************************************************

    COL             GYAINPARDLGPRIAHAILPIAGKGGSNWSYAIVPILGPIAGGLLGAVVYAVFYKHTFNI
    N315            GYAINPARDLGPRIAHAILPIAGKGGSNWSYAIVPILGPIAGGLLGAVVYAVFYKHTFNI
    NCTC8325        GYAINPARDLGPRIAHAILPIAGKGGSNWSYAIVPILGPIAGGLLGAVVYAVFYKHTFNI
    Newman          GYAINPARDLGPRIAHAILPIAGKGGSNWSYAIVPILGPIAGGLLGAVVYAVFYKHTFNI
    USA300_FPR3757  GYAINPARDLGPRIAHAILPIAGKGGSNWSYAIVPILGPIAGGLLGAVVYAVFYKHTFNI
                    ************************************************************

    COL             GCAIAIVVVIITLILGYILNKSSKKGDIESIY
    N315            GCAIAIVVVIITLILGYILNKSSKKGDIESIY
    NCTC8325        GCAIAIVVVIITLILGYILNKSSKKGDIESIY
    Newman          GCAIAIVVVIITLILGYILNKSSKKGDIESIY
    USA300_FPR3757  GCAIAIVVVIITLILGYILNKSSKKGDIESIY
                    ********************************