From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003619000
  • symbol?: hfq
  • description?: host factor-1

      descriptions from strain specific annotations:

    • host factor-1
    • hfq protein
    • RNA chaperone, host factor-1 protein
    • host factor 1 protein
    • RNA chaperone Hfq
    • host factor-I protein Hfq
    • hfq protein, putative
    • RNA-binding protein Hfq
    • phage-related host factor-I protein
    • RNA-binding protein, Hfq family
  • strand?: +
  • coordinates?: 3957836..3958069
  • synteny block?: BlockID0026900
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1261 (hfq)
    08BA02176:
    C248_1338 (hfq)
    11819-97:
    MS7_1261 (hfq)
    71193:
    ST398NM01_1306
    ECT-R 2:
    ECTR2_1161 (hfq)
    ED133:
    SAOV_1305
    ED98:
    SAAV_1278
    HO 5096 0412:
    SAEMRSA15_11380
    JH1:
    SaurJH1_1389
    JH9:
    SaurJH9_1363
    JKD6008:
    SAA6008_01258 (hfq)
    JKD6159:
    SAA6159_01158 (hfq)
    LGA251:
    SARLGA251_12140 (hfq)
    M013:
    M013TW_1245
    MRSA252:
    SAR1279
    MSHR1132:
    SAMSHR1132_11460
    MSSA476:
    SAS1237
    Mu3:
    SAHV_1294
    Mu50:
    SAV1305
    MW2:
    MW1187
    RF122:
    SAB1165
    ST398:
    SAPIG1306 (hfq)
    T0131:
    SAT0131_01360
    TCH60:
    HMPREF0772_11922 (hfq)
    TW20:
    SATW20_12970 (hfq)
    USA300_TCH1516:
    USA300HOU_1235 (hfq)
    VC40:
    SAVC_05715

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIANENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAI
    N315            MIANENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAI
    NCTC8325        MIANENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAI
    Newman          MIANENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAI
    USA300_FPR3757  MIANENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAI
                    ************************************************************

    COL             STYTVETEGQASTESEE
    N315            STYTVETEGQASTESEE
    NCTC8325        STYTVETEGQASTESEE
    Newman          STYTVETEGQASTESEE
    USA300_FPR3757  STYTVETEGQASTESEE
                    *****************