From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan003624000
  • symbol?:
  • description?: Aluminum resistance protein

      descriptions from strain specific annotations:

    • Aluminum resistance protein
    • cystathionine beta-lyase aluminum resistance protein
    • aluminum resistance family protein
    • aluminium resistance protein
  • strand?: +
  • coordinates?: 3961658..3962896
  • synteny block?: BlockID0026940
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1264
    08BA02176:
    C248_1341
    11819-97:
    MS7_1264
    71193:
    ST398NM01_1309
    ECT-R 2:
    ECTR2_1164
    ED133:
    SAOV_1308
    ED98:
    SAAV_1281
    HO 5096 0412:
    SAEMRSA15_11410
    JH1:
    SaurJH1_1392
    JH9:
    SaurJH9_1366
    JKD6008:
    SAA6008_01261
    JKD6159:
    SAA6159_01161
    LGA251:
    SARLGA251_12170 (Alu-2)
    M013:
    M013TW_1248
    MRSA252:
    SAR1282
    MSHR1132:
    SAMSHR1132_11490
    MSSA476:
    SAS1240
    Mu3:
    SAHV_1297
    Mu50:
    SAV1308
    MW2:
    MW1190
    RF122:
    SAB1170
    ST398:
    SAPIG1309
    T0131:
    SAT0131_01363
    TCH60:
    HMPREF0772_11919
    TW20:
    SATW20_13000 (Alu-2)
    USA300_TCH1516:
    USA300HOU_1238
    VC40:
    SAVC_05730

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKDISKIVADVESTLAPYFKEIEETAYINQEKVLNAFHHVKATESDLQGSTGYGYDDFGR
    N315            MKDISKIVADVESTLAPYFKEIEETAYINQEKVLNAFHHVKATESDLQGSTGYGYDDFGR
    NCTC8325        MKDISKIVADVESTLAPYFKEIEETAYINQEKVLNAFHHVKATESDLQGSTGYGYDDFGR
    Newman          MKDISKIVADVESTLAPYFKEIEETAYINQEKVLNAFHHVKATESDLQGSTGYGYDDFGR
    USA300_FPR3757  MKDISKIVADVESTLAPYFKEIEETAYINQEKVLNAFHHVKATESDLQGSTGYGYDDFGR
                    ************************************************************

    COL             DHLEEIYAQAFKAEDAIVRPQIISGTHAITIALQSLLKHGDELIYITGSPYDTLLEVIGV
    N315            DHLEEIYAQAFKAEDAIVRPQIISGTHAITIALQSLLKHGDELIYITGSPYDTLLEVIGV
    NCTC8325        DHLEEIYAQAFKAEDAIVRPQIISGTHAITIALQSLLKHGDELIYITGSPYDTLLEVIGV
    Newman          DHLEEIYAQAFKAEDAIVRPQIISGTHAITIALQSLLKHGDELIYITGSPYDTLLEVIGV
    USA300_FPR3757  DHLEEIYAQAFKAEDAIVRPQIISGTHAITIALQSLLKHGDELIYITGSPYDTLLEVIGV
                    ************************************************************

    COL             NGNGIESLMEHGVSYKDIALKEGKIDIESVLDGVSERTKVIAIQRSKGYDQRPSIPLDEI
    N315            NGNGIESLMEHGVSYKDIALKEGKIDIESVLDGVSERTKVIAIQRSKGYDQRPSIPLDEI
    NCTC8325        NGNGIESLMEHGVSYKDIALKEGKIDIESVLDGVSERTKVIAIQRSKGYDQRPSIPLDEI
    Newman          NGNGIESLMEHGVSYKDIALKEGKIDIESVLDGVSERTKVIAIQRSKGYDQRPSIPLDEI
    USA300_FPR3757  NGNGIESLMEHGVSYKDIALKEGKIDIESVLDGVSERTKVIAIQRSKGYDQRPSIPLDEI
                    ************************************************************

    COL             EKVITRLKNVHPNILIFVDNCYGEFVERREPIECGADLIAGSLIKNPGGGLAKIGGYIAG
    N315            EKVITRLKNVHPNILIFVDNCYGEFVERREPIECGADLIAGSLIKNPGGGLAKIGGYIAG
    NCTC8325        EKVITRLKNVHPNILIFVDNCYGEFVERREPIECGADLIAGSLIKNPGGGLAKIGGYIAG
    Newman          EKVITRLKNVHPNILIFVDNCYGEFVERREPIECGADLIAGSLIKNPGGGLAKIGGYIAG
    USA300_FPR3757  EKVITRLKNVHPNILIFVDNCYGEFVERREPIECGADLIAGSLIKNPGGGLAKIGGYIAG
                    ************************************************************

    COL             RKDLIERCGYRLTAPGIGKEAGASLNALLEMYQGFFLAPHVVSQSLKGALFTSLFLEKMN
    N315            RKDLIERCGYRLTAPGIGKEAGASLNALLEMYQGFFLAPHVVSQSLKGALFTSLFLEKMN
    NCTC8325        RKDLIERCGYRLTAPGIGKEAGASLNALLEMYQGFFLAPHVVSQSLKGALFTSLFLEKMN
    Newman          RKDLIERCGYRLTAPGIGKEAGASLNALLEMYQGFFLAPHVVSQSLKGALFTSLFLEKMN
    USA300_FPR3757  RKDLIERCGYRLTAPGIGKEAGASLNALLEMYQGFFLAPHVVSQSLKGALFTSLFLEKMN
                    ************************************************************

    COL             MNTTPKYYEKRTDLIQTVKFETKEQMISFCQSIQHASPINAHFSPEPSYMPGYEDDVIMA
    N315            MNTTPKYYEKRTDLIQTVKFETKEQMISFCQSIQHASPINAHFSPEPSYMPGYEDDVIMA
    NCTC8325        MNTTPKYYEKRTDLIQTVKFETKEQMISFCQSIQHASPINAHFSPEPSYMPGYEDDVIMA
    Newman          MNTTPKYYEKRTDLIQTVKFETKEQMISFCQSIQHASPINAHFSPEPSYMPGYEDDVIMA
    USA300_FPR3757  MNTTPKYYEKRTDLIQTVKFETKEQMISFCQSIQHASPINAHFSPEPSYMPGYEDDVIMA
                    ************************************************************

    COL             AGTFIQGSSIELSADGPIRPPYEAYVQGGLTYEHVKIAVTRAVNQLKEQGLI
    N315            AGTFIQGSSIELSADGPIRPPYEAYVQGGLTYEHVKIAVTRAVNQLKEQGLI
    NCTC8325        AGTFIQGSSIELSADGPIRPPYEAYVQGGLTYEHVKIAVTRAVNQLKEQGLI
    Newman          AGTFIQGSSIELSADGPIRPPYEAYVQGGLTYEHVKIAVTRAVNQLKEQGLI
    USA300_FPR3757  AGTFIQGSSIELSADGPIRPPYEAYVQGGLTYEHVKIAVTRAVNQLKEQGLI
                    ****************************************************