From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003631000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3966825..3967031
  • synteny block?: BlockID0027010
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1267
    08BA02176:
    C248_1345
    11819-97:
    MS7_1269
    71193:
    ST398NM01_1313
    ECT-R 2:
    ECTR2_1168
    ED133:
    SAOV_1313
    ED98:
    SAAV_1286
    HO 5096 0412:
    SAEMRSA15_11460
    JH1:
    SaurJH1_1397
    JH9:
    SaurJH9_1370
    JKD6008:
    SAA6008_01266
    JKD6159:
    SAA6159_01165
    LGA251:
    SARLGA251_12230
    M013:
    M013TW_1253
    MRSA252:
    SAR1303
    MSHR1132:
    SAMSHR1132_11530
    MSSA476:
    SAS1245
    Mu3:
    SAHV_1300
    Mu50:
    SAV1311
    MW2:
    MW1193
    RF122:
    ST398:
    SAPIG1313
    T0131:
    SAT0131_01369
    TCH60:
    HMPREF0772_11914
    TW20:
    SATW20_13050
    USA300_TCH1516:
    USA300HOU_1243
    VC40:
    SAVC_05750

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNEIETIISEIEKLLTNNTPYSISKNSGVPRQTVTDLKVGKTKIKEAKFKTIIKLYEYQR
    N315            MNEIETIISEIEKLLTNNTPYSISKNSGVPRQTVTDLKVGKTKIKEAKFKTIIKLYEYQR
    NCTC8325        MNEIETIISEIEKLLTNNTPYSISKNSGVPRQTVTDLKVGKTKIKEAKFKTIIKLYEYQR
    Newman          MNEIETIISEIEKLLTNNTPYSISKNSGVPRQTVTDLKVGKTKIKEAKFKTIIKLYEYQR
    USA300_FPR3757  MNEIETIISEIEKLLTNNTPYSISKNSGVPRQTVTDLKVGKTKIKEAKFKTIIKLYEYQR
                    ************************************************************

    COL             TLENKTEC
    N315            TLENKTEC
    NCTC8325        TLENKTEC
    Newman          TLENKTEC
    USA300_FPR3757  TLENKTEC
                    ********