From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003635000
  • symbol?:
  • description?: DNA-binding protein

      descriptions from strain specific annotations:

    • DNA-binding protein
    • putative DNA-binding protein
    • pseudogene
  • strand?: +
  • coordinates?: 3969606..3969726
  • synteny block?: BlockID0027050
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1268
    08BA02176:
    C248_1346
    11819-97:
    MS7_1270
    71193:
    ST398NM01_1314
    ECT-R 2:
    ECTR2_1169
    ED133:
    SAOV_1315
    ED98:
    SAAV_1288
    HO 5096 0412:
    SAEMRSA15_11470
    JH1:
    SaurJH1_1399
    JH9:
    SaurJH9_1371
    JKD6008:
    SAA6008_01268
    JKD6159:
    SAA6159_01166
    LGA251:
    SARLGA251_12240
    M013:
    M013TW_1254
    MRSA252:
    SAR1304
    MSHR1132:
    SAMSHR1132_11540
    MSSA476:
    SAS1246
    Mu3:
    SAHV_1301
    Mu50:
    SAV1312
    MW2:
    MW1194
    RF122:
    SAB1173
    ST398:
    SAPIG1314
    T0131:
    SAT0131_01370
    TCH60:
    HMPREF0772_11912
    TW20:
    SATW20_13060
    USA300_TCH1516:
    USA300HOU_1245
    VC40:
    SAVC_05755

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSEYKKKIIELIESNLTGYEISKKTGVSQYVLSQLRQGKREVDNLTLNTTEKLYEYANKV
    N315            MSEYKKKIIELIESNLTGYEISKKTGVSQYVLSQLRQGKREVDNLTLNTTEKLYEYANKV
    NCTC8325        MSEYKKKIIELIESNLTGYEISKKTGVSQYVLSQLRQGKREVDNLTLNTTEKLYEYANKV
    Newman          MSEYKKKIIELIESNLTGYEISKKTGVSQYVLSQLRQGKREVDNLTLNTTEKLYEYANKV
    USA300_FPR3757  MSEYKKKIIELIESNLTGYEISKKTGVSQYVLSQLRQGKREVDNLTLNTTEKLYEYANKV
                    ************************************************************

    COL             L
    N315            L
    NCTC8325        L
    Newman          L
    USA300_FPR3757  L
                    *