From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003673000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3985969..3988322
  • synteny block?: BlockID0027410
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1270
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_1174
    ED133:
    SAOV_1328
    ED98:
    SAAV_1294
    HO 5096 0412:
    SAEMRSA15_11610
    JH1:
    SaurJH1_1403
    JH9:
    SaurJH9_1376
    JKD6008:
    SAA6008_01279
    JKD6159:
    SAA6159_01181
    LGA251:
    M013:
    MRSA252:
    SAR1325
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_1303
    Mu50:
    SAV1314
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_01382
    TCH60:
    HMPREF0772_11894
    TW20:
    SATW20_13170
    USA300_TCH1516:
    USA300HOU_1258
    VC40:
    SAVC_05810

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNLQSYIGKLVKLTLTNNKILIGKVIDFDDKVDNFDGYNSIEIDTGRITYDISENKIKTI
    N315            MNLQSYIGKLVKLTLTNNKILIGKVIDFDDKVDNFDGYNSIEIDTGRITYDISENKIKTI
    NCTC8325        MNLQSYIGKLVKLTLTNNKILIGKVIDFDDKVDNFDGYNSIEIDTGRITYDISENKIKTI
    Newman          MNLQSYIGKLVKLTLTNNKILIGKVIDFDDKVDNFDGYNSIEIDTGRITYDISENKIKTI
    USA300_FPR3757  MNLQSYIGKLVKLTLTNNKILIGKVIDFDDKVDNFDGYNSIEIDTGRITYDISENKIKTI
                    ************************************************************

    COL             VLQ-
    N315            VLQK
    NCTC8325        VLQ-
    Newman          VLQ-
    USA300_FPR3757  VLQ-
                    ***