From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003682000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3991294..3991491
  • synteny block?: BlockID0027480
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1272
    08BA02176:
    C248_1355
    11819-97:
    MS7_1280
    71193:
    ST398NM01_1323
    ECT-R 2:
    ECTR2_1176
    ED133:
    SAOV_1330
    ED98:
    SAAV_1296
    HO 5096 0412:
    SAEMRSA15_11640
    JH1:
    SaurJH1_1405
    JH9:
    SaurJH9_1378
    JKD6008:
    SAA6008_01281
    JKD6159:
    SAA6159_01184
    LGA251:
    SARLGA251_12300
    M013:
    M013TW_1269
    MRSA252:
    SAR1327
    MSHR1132:
    SAMSHR1132_11620
    MSSA476:
    SAS1257
    Mu3:
    SAHV_1305
    Mu50:
    SAV1316
    MW2:
    MW1204
    RF122:
    SAB1179
    ST398:
    SAPIG1323
    T0131:
    SAT0131_01384
    TCH60:
    HMPREF0772_11892
    TW20:
    SATW20_13190
    USA300_TCH1516:
    USA300HOU_1261
    VC40:
    SAVC_05825

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEQIKLKTFTAETLELLEKNINAFLSSEEATNLKLVNITIKEIEERTFPNNEEEFNAILT
    N315            MEQIKLKTFTAETLELLEKNINAFLSSEEATNLKLVNITIKEIEERTFPNNEEEFNAILT
    USA300_FPR3757  MEQIKLKTFTAETLELLEKNINAFLSSEEATNLKLVNITIKEIEERTFPNNEEEFNAILT
                    ************************************************************

    COL             LSVNK
    N315            LSVNK
    USA300_FPR3757  LSVNK
                    *****