From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003690000
  • symbol?:
  • description?: DNA-binding response regulator

      descriptions from strain specific annotations:

    • DNA-binding response regulator
    • LuxR family DNA-binding response regulator
    • two-component response regulator
    • response regulator protein
    • response regulator receiver
    • two component LuxR family transcriptional regulator
  • strand?: +
  • coordinates?: 3996999..3998404
  • synteny block?: BlockID0027560
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1277
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_1181
    ED133:
    SAOV_1335
    ED98:
    SAAV_1301
    HO 5096 0412:
    SAEMRSA15_11690
    JH1:
    SaurJH1_1410
    JH9:
    SaurJH9_1383
    JKD6008:
    SAA6008_01286
    JKD6159:
    SAA6159_01189
    LGA251:
    M013:
    MRSA252:
    SAR1332
    MSHR1132:
    SAMSHR1132_11670
    MSSA476:
    SAS1262
    Mu3:
    SAHV_1311
    Mu50:
    SAV1322
    MW2:
    MW1209
    RF122:
    ST398:
    T0131:
    SAT0131_01390
    TCH60:
    HMPREF0772_11886
    TW20:
    SATW20_13240
    USA300_TCH1516:
    USA300HOU_1266
    VC40:
    SAVC_05850

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTSLIIAEDQNMLRQAMVQLIKLHGDFEILADTDNGLDAMKLIEEYNPNVVILDIEMPGM
    N315            MTSLIIAEDQNMLRQAMVQLIKLHGDFEILADTDNGLDAMKLIEEYNPNVVILDIEMPGM
    NCTC8325        MTSLIIAEDQNMLRQAMVQLIKLHGDFEILADTDNGLDAMKLIEEYNPNVVILDIEMPGM
    Newman          MTSLIIAEDQNMLRQAMVQLIKLHGDFEILADTDNGLDAMKLIEEYNPNVVILDIEMPGM
    USA300_FPR3757  MTSLIIAEDQNMLRQAMVQLIKLHGDFEILADTDNGLDAMKLIEEYNPNVVFLDIEMPGM
                    ***************************************************:********

    COL             TGLEVLAEIRKKHLNIKVIIVTTFKRPGYFEKAVVNDVDAYVLKERSIEELVETINKVNN
    N315            TGLEVLAEIRKKHLNIKVIIVTTFKRPGYFEKAVVNDVDAYVLKERSIEELVETINKVNN
    NCTC8325        TGLEVLAEIRKKHLNIKVIIVTTFKRPGYFEKAVVNDVDAYVLKERSIEELVETINKVNN
    Newman          TGLEVLAEIRKKHLNIKVIIVTTFKRPGYFEKAVVNDVDAYVLKERSIEELVETINKVNN
    USA300_FPR3757  TGLEVLAEIRKKHLNIKVIIVTTFKRPGYFEKAVVNDVDAYVLKERSIEELVETINKVNN
                    ************************************************************

    COL             GEKEYSATLMTSFFVDKNPLTPKEQIVLREIGNGLSSKEISEKLFLTDGTVRNYTSVIID
    N315            GEKEYSATLMTSFFVDKNPLTPKEQIVLREIGNGLSSKEISEKLFLTDGTVRNYTSVIID
    NCTC8325        GEKEYSATLMTSFFVDKNPLTPKEQIVLREIGNGLSSKEISEKLFLTDGTVRNYTSVIID
    Newman          GEKEYSATLMTSFFVDKNPLTPKEQIVLREIGNGLSSKEISEKLFLTDGTVRNYTSVIID
    USA300_FPR3757  GEKEYSATLMTSFFVDKNPLTPKEQIVLREIGNGLSSKEISEKLFLTDGTVRNYTSVIID
                    ************************************************************

    COL             KLFADNRFDAWKKANEKGWI
    N315            KLFADNRFDAWKKANEKGWI
    NCTC8325        KLFADNRFDAWKKANEKGWI
    Newman          KLFADNRFDAWKKANEKGWI
    USA300_FPR3757  KLFADNRFDAWKKANEKGWI
                    ********************