From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003703000
  • symbol?:
  • description?: cof family hydrolase

      descriptions from strain specific annotations:

    • cof family hydrolase
    • HAD superfamily hydrolase
    • Hydrolase (HAD superfamily)
    • cof-like hydrolase family protein
    • haloacid dehalogenase-like hydrolase
    • HAD family phosphatase
  • strand?: +
  • coordinates?: 4007675..4008478
  • synteny block?: BlockID0027690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1286
    08BA02176:
    C248_1366
    11819-97:
    MS7_1290
    71193:
    ST398NM01_1333
    ECT-R 2:
    ECTR2_1190
    ED133:
    SAOV_1344
    ED98:
    SAAV_1311
    HO 5096 0412:
    SAEMRSA15_11780
    JH1:
    SaurJH1_1419
    JH9:
    SaurJH9_1392
    JKD6008:
    SAA6008_01297
    JKD6159:
    SAA6159_01198
    LGA251:
    SARLGA251_12400
    M013:
    M013TW_1279
    MRSA252:
    SAR1341
    MSHR1132:
    SAMSHR1132_11760
    MSSA476:
    SAS1271
    Mu3:
    SAHV_1320
    Mu50:
    SAV1331
    MW2:
    MW1218
    RF122:
    SAB1189
    ST398:
    SAPIG1333
    T0131:
    SAT0131_01402
    TCH60:
    HMPREF0772_11877
    TW20:
    SATW20_13330
    USA300_TCH1516:
    USA300HOU_1276
    VC40:
    SAVC_05895

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNYKVVVLDMDDTLLNSDNVISEETANYLTAIQDEGYYVVLASGRPTEGMIPTARDLKL
    N315            MTNYKVVVLDMDDTLLNSDNVISEETANYLTAIQDEGYYVVLASGRPTEGMIPTARDLKL
    NCTC8325        MTNYKVVVLDMDDTLLNSDNVISEETANYLTAIQDEGYYVVLASGRPTEGMIPTARDLKL
    Newman          MTNYKVVVLDMDDTLLNSDNVISEETANYLTAIQDEGYYVVLASGRPTEGMIPTARDLKL
    USA300_FPR3757  MTNYKVVVLDMDDTLLNSDNVISEETANYLTAIQDEGYYVVLASGRPTEGMIPTARDLKL
                    ************************************************************

    COL             PEHHSYIISYNGSKTINMTNEEVEVSKSIGKQDFDEIVDYCRDRGFFVLTYHDGQIIYDS
    N315            PEHHSYIISYNGSKTINMTNEEVEVSKSIGKQDFDEIVDYCRDRGFFVLTYHDGQIIYDS
    NCTC8325        PEHHSYIISYNGSKTINMTNEEVEVSKSIGKQDFDEIVDYCRDRGFFVLTYHDGQIIYDS
    Newman          PEHHSYIISYNGSKTINMTNEEVEVSKSIGKQDFDEIVDYCRDRGFFVLTYHDGQIIYDS
    USA300_FPR3757  PEHHSYIISYNGSKTINMTNEEVEVSKSIGKQDFDEIVDYCRDRGFFVLTYHDGQIIYDS
                    ************************************************************

    COL             EHEYMNIEAELTGLPMKRVDDIKAYIQGDVPKVMGVDYVANITEARIDLNGVFNDNVDAT
    N315            EHEYMNIEAELTGLPMKRVDDIKAYIQGDVPKVMGVDYVANITEARIDLNGVFNDNVDAT
    NCTC8325        EHEYMNIEAELTGLPMKRVDDIKAYIQGDVPKVMGVDYVANITEARIDLNGVFNDNVDAT
    Newman          EHEYMNIEAELTGLPMKRVDDIKAYIQGDVPKVMGVDYVANITEARIDLNGVFNDNVDAT
    USA300_FPR3757  EHEYMNIEAELTGLPMKRVDDIKAYIQGDVPKVMGVDYVANITEARIDLNGVFNDNVDAT
                    ************************************************************

    COL             TSKPFFLEFMAKDVSKGNAIKALCHKLGYSVDQVIAFGDSMNDKSMFEVAGLAIAMGNAS
    N315            TSKPFFLEFMAKDVSKGNAIKALCHKLGYSVDQVIAFGDSMNDKSMFEVAGLAIAMGNAS
    NCTC8325        TSKPFFLEFMAKDVSKGNAIKALCHKLGYSVDQVIAFGDSMNDKSMFEVAGLAIAMGNAS
    Newman          TSKPFFLEFMAKDVSKGNAIKALCHKLGYSVDQVIAFGDSMNDKSMFEVAGLAIAMGNAS
    USA300_FPR3757  TSKPFFLEFMAKDVSKGNAIKALCHKLGYSVDQVIAFGDSMNDKSMFEVAGLAIAMGNAS
                    ************************************************************

    COL             DELKQYANEVTLDHNENGIPHALKKLL
    N315            DELKQYADEVTLDHNENGIPHALKKLL
    NCTC8325        DELKQYANEVTLDHNENGIPHALKKLL
    Newman          DELKQYANEVTLDHNENGIPHALKKLL
    USA300_FPR3757  DELKQYANEVTLDHNENGIPHALKKLL
                    *******:*******************