From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003704000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 4008950..4009264
  • synteny block?: BlockID0027700
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1287
    08BA02176:
    C248_1367
    11819-97:
    MS7_1291
    71193:
    ST398NM01_1334
    ECT-R 2:
    ECTR2_1191
    ED133:
    SAOV_1345c
    ED98:
    SAAV_1312
    HO 5096 0412:
    SAEMRSA15_11790
    JH1:
    SaurJH1_1420
    JH9:
    SaurJH9_1393
    JKD6008:
    SAA6008_01298
    JKD6159:
    SAA6159_01199
    LGA251:
    SARLGA251_12410
    M013:
    M013TW_1280
    MRSA252:
    SAR1342
    MSHR1132:
    SAMSHR1132_11770
    MSSA476:
    SAS1272
    Mu3:
    SAHV_1321
    Mu50:
    SAV1332
    MW2:
    MW1219
    RF122:
    SAB1190c
    ST398:
    SAPIG1334
    T0131:
    SAT0131_01403
    TCH60:
    HMPREF0772_11876
    TW20:
    SATW20_13340
    USA300_TCH1516:
    VC40:
    SAVC_05900

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIGQTNLFDDVLKQDERFVIVVQALEEKNGQLLKRTLREYPGLNHKQMNDLFMHLKELFS
    N315            MIGQTNLFDDVLKQDERFVIVVQALEEKNGQLLKRTLREYPGLNHKQMNDLFTHLKELFS
    NCTC8325        MIGQTNLFDDVLKQDERFVIVVQALEEKNGQLLKRTLREYPGLNHKQMNDLFMHLKELFS
    Newman          MIGQTNLFDDVLKQDERFVIVVQALEEKNGQLLKRTLREYPGLNHKQMNDLFMHLKELFS
    USA300_FPR3757  MIGQTNLFDDVLKQDERFVIVVQALEEKNGQLLKRTLREYPGLNHKQMNDLFMHLKELFS
                    **************************************************** *******

    COL             EESFAENQSAFSITVYTNLDYTADQIYAHVKRFRGKHDWTQTAK
    N315            EESFAENQSAFSITVYTNLDYTADQIYAHVKRFRGKHDWTQTAK
    NCTC8325        EESFAENQSAFSITVYTNLDYTADQIYAHVKRFRGKHDWTQTAK
    Newman          EESFAENQSAFSITVYTNLDYTADQIYAHVKRFRGKHDWTQTAK
    USA300_FPR3757  EESFAENQSAFSITVYTNLDYTADQIYAHVKRFRGKHDWTQTAK
                    ********************************************