From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003706000
  • symbol?:
  • description?: gamma-aminobutyrate permease

      descriptions from strain specific annotations:

    • gamma-aminobutyrate permease
    • amino acid permease
    • APC family amino acid-polyamine-organocation transporter
    • lysine-specific permease
    • amino acid permease family protein
    • Amino acid permease-associated region
    • APC family lysine-specific permease
  • strand?: -
  • coordinates?: 4009594..4011048
  • synteny block?: BlockID0027720
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1288
    08BA02176:
    C248_1369
    11819-97:
    MS7_1292
    71193:
    ST398NM01_1335
    ECT-R 2:
    ECTR2_1192
    ED133:
    SAOV_1346c
    ED98:
    SAAV_1313
    HO 5096 0412:
    SAEMRSA15_11800
    JH1:
    SaurJH1_1421
    JH9:
    SaurJH9_1394
    JKD6008:
    SAA6008_01299
    JKD6159:
    SAA6159_01200
    LGA251:
    SARLGA251_12420
    M013:
    M013TW_1281
    MRSA252:
    SAR1343
    MSHR1132:
    SAMSHR1132_11780
    MSSA476:
    SAS1273
    Mu3:
    SAHV_1322
    Mu50:
    SAV1333
    MW2:
    MW1220
    RF122:
    SAB1191c
    ST398:
    SAPIG1335
    T0131:
    SAT0131_01404
    TCH60:
    HMPREF0772_11875 (lysP2)
    TW20:
    SATW20_13350
    USA300_TCH1516:
    VC40:
    SAVC_05905

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEDNKMNRSLNSRHISMIAIGGAIGTGLFVATGNIISQAGPGGAILAYLVIGVMLYFLMS
    N315            MEDNKMNRSLNSRHISMIAIGGAIGTGLFVATGNIISQAGPGGAILAYLVIGVMLYFLMS
    NCTC8325        MEDNKMNRSLNSRHISMIAIGGAIGTGLFVATGNIISQAGPGGAILAYLVIGVMLYFLMS
    Newman          MEDNKMNRSLNSRHISMIAIGGAIGTGLFVATGNIISQAGPGGAILAYLVIGVMLYFLMS
    USA300_FPR3757  MEDNKMNRSLNSRHISMIAIGGAIGTGLFVATGNIISQAGPGGAILAYLVIGVMLYFLMS
                    ************************************************************

    COL             SIGELATFYPVSGSFSSYSTRFIDSSLGFTMGWLYWALWSLVTSVDVIVASNVLYFWDTF
    N315            SIGELATFYPVSGSFSSYSTRFIDSSLGFTMGWLYWALWSLVTSVDVIVASNVLYFWDTF
    NCTC8325        SIGELATFYPVSGSFSSYSTRFIDSSLGFTMGWLYWALWSLVTSVDVIVASNVLYFWDTF
    Newman          SIGELATFYPVSGSFSSYSTRFIDSSLGFTMGWLYWALWSLVTSVDVIVASNVLYFWDTF
    USA300_FPR3757  SIGELATFYPVSGSFSSYSTRFIDSSLGFTMGWLYWALWSLVTSVDVIVASNVLYFWDTF
                    ************************************************************

    COL             KFFHPITWSLIFITILLLLNIFSVKSFGETEFWLSLIKVLTIIVFVIFGFLMIFGILGGH
    N315            KFFHPITWSLIFITILLLLNIFSVKSFGETEFWLSLIKVLTIIVFVIFGFLMIFGILGGH
    NCTC8325        KFFHPITWSLIFITILLLLNIFSVKSFGETEFWLSLIKVLTIIVFVIFGFLMIFGILGGH
    Newman          KFFHPITWSLIFITILLLLNIFSVKSFGETEFWLSLIKVLTIIVFVIFGFLMIFGILGGH
    USA300_FPR3757  KFFHPITWSLIFITILLLLNIFSVKSFGETEFWLSLIKVLTIIVFVIFGFLMIFGILGGH
                    ************************************************************

    COL             TYGFENYTKGQAPFVGGISGFLGVLLVAGFSVGGTEVVAVTAGESDDPKKSMPKAIKQVF
    N315            TYGFENYTKGQAPFVGGISGFLGVLLVAGFSVGGTEVVAVTAGESDDPKKSMPKAIKQVF
    NCTC8325        TYGFENYTKGQAPFVGGISGFLGVLLVAGFSVGGTEVVAVTAGESDDPKKSMPKAIKQVF
    Newman          TYGFENYTKGQAPFVGGISGFLGVLLVAGFSVGGTEVVAVTAGESDDPKKSMPKAIKQVF
    USA300_FPR3757  TYGFENYTKGQAPFVGGISGFLGVLLVAGFSVGGTEVVAVTAGESDDPKKSMPKAIKQVF
                    ************************************************************

    COL             WRILLFYVLSIAVIGAIIPYTDPSLLRASSSISQSPFTIVFDRVGIAFAASVINAVILTS
    N315            WRILLFYVLSIAVIGAIIPYTDPSLLRASSSISQSPFTIVFDRVGIAFAASVINAVILTS
    NCTC8325        WRILLFYVLSIAVIGAIIPYTDPSLLRASSSISQSPFTIVFDRVGIAFAASVINAVILTS
    Newman          WRILLFYVLSIAVIGAIIPYTDPSLLRASSSISQSPFTIVFDRVGIAFAASVINAVILTS
    USA300_FPR3757  WRILLFYVLSIAVIGAIIPYTDPSLLRASSSISQSPFTIVFDRVGIAFAASVINAVILTS
                    ************************************************************

    COL             LLSAANSGVYTTGRMLYSLSSDKKAPQFLSKLNKTTKLPLRALLTTYAVVVIVIIYANFN
    N315            LLSAANSGVYTTGRMLYSLSSDKKAPQFLSKLNKTTKLPLRALLTTYAVVVIVIIYANFN
    NCTC8325        LLSAANSGVYTTGRMLYSLSSDKKAPQFLSKLNKTTKLPLRALLTTYAVVVIVIIYANFN
    Newman          LLSAANSGVYTTGRMLYSLSSDKKAPQFLSKLNKTTKLPLRALLTTYAVVVIVIIYANFN
    USA300_FPR3757  LLSAANSGVYTTGRMLYSLSSDKKAPQFLSKLNKTTKLPLRALLTTYAVVVIVIIYANFN
                    ************************************************************

    COL             SNAVFNLLEIIGSMIIVVWGSSIWSQIRLRQAIKKQGQDPNKVLPYKAPFYPLGPIIVIT
    N315            SNAVFNLLEIIGSMIIVVWGSSIWSQIRLRQAIKKQGQDPNKVLPYKAPFYPLGPIIVIT
    NCTC8325        SNAVFNLLEIIGSMIIVVWGSSIWSQIRLRQAIKKQGQDPNKVLPYKAPFYPLGPIIVIT
    Newman          SNAVFNLLEIIGSMIIVVWGSSIWSQIRLRQAIKKQGQDPNKVLPYKAPFYPLGPIIVIT
    USA300_FPR3757  SNAVFNLLEIIGSMIIVVWGSSIWSQIRLRQAIKKQGQDPNKVLPYKAPFYPLGPIIVIT
                    ************************************************************

    COL             TLLFLLFGGSVEYILKDQWLNAFKNFLPLIILALIYFIHKIIHKTKFVKLETINLKPHDY
    N315            TLLFLLFGGSVEYILKDQWLNAFKNFLPLIILALIYFIHKIIHKTKFVKLETINLKPHDY
    NCTC8325        TLLFLLFGGSVEYILKDQWLNAFKNFLPLIILALIYFIHKIIHKTKFVKLETINLKPHDY
    Newman          TLLFLLFGGSVEYILKDQWLNAFKNFLPLIILALIYFIHKIIHKTKFVKLETINLKPHDY
    USA300_FPR3757  TLLFLLFGGSVEYILKDQWLNAFKNFLPLIILALIYFIHKIIHKTKFVKLETINLKPHDY
                    ************************************************************

    COL             DNQK
    N315            DNQK
    NCTC8325        DNQK
    Newman          DNQK
    USA300_FPR3757  DNQK
                    ****