From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003721000
  • symbol?: sbcD
  • description?: exonuclease SbcD

      descriptions from strain specific annotations:

    • exonuclease SbcD
    • nuclease SbcCD subunit D
    • putative exonuclease
    • DNA repair exonuclease
    • exonuclease SbcCD subunit D
    • SbcD protein
  • strand?: +
  • coordinates?: 4021449..4022591
  • synteny block?: BlockID0027870
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1381 (sbcD)
    N315:
    NCTC8325:
    Newman:
    NWMN_1257 (sbcD)
    USA300_FPR3757:
    04-02981:
    SA2981_1300 (sbcD)
    08BA02176:
    C248_1381
    11819-97:
    MS7_1304 (sbcD)
    71193:
    ST398NM01_1347
    ECT-R 2:
    ECTR2_1204 (sbcD)
    ED133:
    SAOV_1358
    ED98:
    SAAV_1326 (sbcD)
    HO 5096 0412:
    SAEMRSA15_11920
    JH1:
    SaurJH1_1434
    JH9:
    SaurJH9_1407
    JKD6008:
    SAA6008_01311 (sbcD)
    JKD6159:
    SAA6159_01212 (sbcD)
    LGA251:
    SARLGA251_12540
    M013:
    M013TW_1293
    MRSA252:
    SAR1356
    MSHR1132:
    SAMSHR1132_11900
    MSSA476:
    SAS1285
    Mu3:
    SAHV_1334
    Mu50:
    SAV1345
    MW2:
    MW1232
    RF122:
    SAB1203
    ST398:
    SAPIG1347
    T0131:
    SAT0131_01416 (nirB)
    TCH60:
    HMPREF0772_11863 (sbcD)
    TW20:
    SATW20_13470
    USA300_TCH1516:
    VC40:
    SAVC_05965

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIIHTADWHLGKILNGKQLLEDQAYILDMFVEKMKEEEPDIIVIAGDLYDTTYPSKDAI
    N315            MKIIHTADWHLGKILNGKQLLEDQAYILDMFVEKMKEEEPDIIVIAGDLYDTTYPSKDAI
    NCTC8325        MKIIHTADWHLGKILNGKQLLEDQAYILDMFVEKMKEEEPDIIVIAGDLYDTTYPSKDAI
    Newman          MKIIHTADWHLGKILNGKQLLEDQAYILDMFVEKMKEEEPDIIVIAGDLYDTTYPSKDAI
    USA300_FPR3757  MKIIHTADWHLGKILNGKQLLEDQAYILDMFVEKMKEEEPDIIVIAGDLYDTTYPSKDAI
                    ************************************************************

    COL             MLLEQAIGKLNLELRIPIIIISGNHDGKERLNYGASWFEHNQLFIRTDFTSINSPIEING
    N315            MLLEQAIGKLNLELRIPIIMISGNHDGKERLNYGASWFEHNQLFIRTDFTSINSPIEING
    NCTC8325        MLLEQAIGKLNLELRIPIIIISGNHDGKERLNYGASWFEHNQLFIRTDFTSINSPIEING
    Newman          MLLEQAIGKLNLELRIPIIIISGNHDGKERLNYGASWFEHNQLFIRTDFTSINSPIEING
    USA300_FPR3757  MLLEQAIGKLNLELRIPIIIISGNHDGKERLNYGASWFEHNQLFIRTDFTSINSPIEING
                    *******************:****************************************

    COL             VNFYTLPYATVSEMKHYFEDDTIETHQQGITRCIETIAPEIDEDAVNILISHLTVQGGKT
    N315            VNFYTLPYATVSEMKHYFEDDTIETHQQGITRCIETIAPEIDEDAVNILISHLTVQGGKT
    NCTC8325        VNFYTLPYATVSEMKHYFEDDTIETHQQGITRCIETIAPEIDEDAVNILISHLTVQGGKT
    Newman          VNFYTLPYATVSEMKHYFEDDTIETHQQGITRCIETIAPEIDEDAVNILISHLTVQGGKT
    USA300_FPR3757  VNFYTLPYATVSEMKHYFEDDTIETHQQGITRCIETIAPEIDEDAVNILISHLTVQGGKT
                    ************************************************************

    COL             SDSERPLTIGTVESVQKGVFDIFDYVMLGHLHHPFSIEDDKIKYSGSLLQYSFSEAGQAK
    N315            SDSERPLTIGTVESVQKGVFDIFDYVMLGHLHHPFSIEDDKIKYSGSLLQYSFSEAGQAK
    NCTC8325        SDSERPLTIGTVESVQKGVFDIFDYVMLGHLHHPFSIEDDKIKYSGSLLQYSFSEAGQAK
    Newman          SDSERPLTIGTVESVQKGVFDIFDYVMLGHLHHPFSIEDDKIKYSGSLLQYSFSEAGQAK
    USA300_FPR3757  SDSERPLTIGTVESVQKGVFDIFDYVMLGHLHHPFSIEDDKIKYSGSLLQYSFSEAGQAK
                    ************************************************************

    COL             GYRRVTINDGIINDVFIPLKPLRQLEIISGEYNDVINEKVHVKNKDNYLHFKLKNMSHIT
    N315            GYRRLTINDGIINDVFIPLKPLRQLEIISGEYNDVINEKVHVKNKDNYLHFKLKNMSHIT
    NCTC8325        GYRRVTINDGIINDVFIPLKPLRQLEIISGEYNDVINEKVHVKNKDNYLHFKLKNMSHIT
    Newman          GYRRVTINDGIINDVFIPLKPLRQLEIISGEYNDVINEKVHVKNKDNYLHFKLKNMSHIT
    USA300_FPR3757  GYRRVTINDGIINDVFIPLKPLRQLEIISGEYNDVINEKVHVKNKDNYLHFKLKNMSHIT
                    ****:*******************************************************

    COL             DPMMSLKQIYPNTLALTNETFNYNEENNAIEISEKDDMSIIEMFYKHITDKELSDIQSKK
    N315            DPMMSLKQIYPNTLALTNETFNYNEENNAIEISEKDDMSIIEMFYKHITDKELSDIQSKK
    NCTC8325        DPMMSLKQIYPNTLALTNETFNYNEENNAIEISEKDDMSIIEMFYKHITDKELSDIQSKK
    Newman          DPMMSLKQIYPNTLALTNETFNYNEENNAIEISEKDDMSIIEMFYKHITDKELSDIQSKK
    USA300_FPR3757  DPMMSLKQIYPNTLALTNETFNYNEENNAIEISEKDDMSIIEMFYKHITDKELSDIQSKK
                    ************************************************************

    COL             IKNILENELRKED
    N315            IKNILENELRKED
    NCTC8325        IKNILENELRKED
    Newman          IKNILENELRKED
    USA300_FPR3757  IKNILENELRKED
                    *************